expression of the chromosomal mouse βmaj-globin gene cloned in sv40

6

© Nature Publishing Group 1979

Upload: philip

Post on 21-Jul-2016

212 views

Category:

Documents

0 download

Report

Download

Embed Size (px):

TRANSCRIPT

Page 1: Expression of the chromosomal mouse βmaj-globin gene cloned in SV40

© Nature Publishing Group1979

Page 2: Expression of the chromosomal mouse βmaj-globin gene cloned in SV40

© Nature Publishing Group1979

Page 3: Expression of the chromosomal mouse βmaj-globin gene cloned in SV40

© Nature Publishing Group1979

Page 4: Expression of the chromosomal mouse βmaj-globin gene cloned in SV40

© Nature Publishing Group1979

Page 5: Expression of the chromosomal mouse βmaj-globin gene cloned in SV40

© Nature Publishing Group1979

Page 6: Expression of the chromosomal mouse βmaj-globin gene cloned in SV40

Cloned transgenic cattle produce milk with higher levels of β-casein ...gmofree-euroregions.regione.marche.it/Portals/0/Brophy_2003.pdf · Cloned transgenic cattle produce milk with

ija 3 - studentski.netstudentski.net/get/ulj_ffa_fa1_fk3_sno_protivirusne_ucinkovine_01.pdf · Polioma virusi SV40 Razne kožne papilomatozne infekcije (bradavice) Mumps Multifokalna

POLIOMAVIRUS (BK, JC, SV40) La famiglia Papovaviridae non ... · acilazione, glicosilazione, adenilazione etc.) Antigene T (trasformazione) ... Omologia con il dominio J della famiglia

SANTÉ Vaccination Le scandale du SV40

β-globin gene transfer to human bone marrow for sickle ...€¦ · β-globin gene transfer to human bone marrow for sickle cell disease Zulema Romero, 1 Fabrizia Urbinati,1 Sabine

UNIVERSITAT DE BARCELONA FACULTAT DE BIOLOGIA … · ii 4- SV40. UN POLIOMAVIRUS HUMÀ? 4.1. El descobriment de SV40 27 4.2. Les propietats transformants de SV40 28 4.3. Els hostes

Increased erythrold-specific expression of a mutated HPFH γ-globin

第八章克隆基因的表达 Expression of Cloned Genes

Expression Vector Expression of cloned genes produces large quantities of protein Components of expression vector 1. replication origin 2. polylingker

Anemia Karena Kelainan Sintesis Globin

-Globin Gene Regulation and Nuclear Organisation

PENAPISAN MUTASI GEN BETA GLOBIN PADASISWI SMAN 1 …

TELAAH PEMERIKSAAN HB ELEKTROFORESIS ...repository.poltekkesjakarta3.ac.id/repository/KTI...sintesis rantai α-globin atau rantai -globin. Data dari Yayasan Thalassaemia Indonesia,

Immunostick Test for Detecting ζ-Globin Chains and

Glasnik srpskog istorijsko-kulturnog drustva Njegos sv40

Troubleshoot Networking Pada Cloned Linux CentOS 6.8 Virtual Machine di VMWare Workstation 12

-globin subunits for hemoglobin synthesis · to the α thalassemia silent carrier strain, termed α-globin*α/αα, which lacks 1 of 4 α- globin genes and exhibits minimal erythroid

Polyomaviridae Taxonomie Ehemals Unterfamilie der … · 2011. 5. 8. · K-Papovavirus (KPV) Maus: Simian Virus 40 (SV40) Rhesus Affe: Lymphotropic Papovavirus (LPV) Afrikanische

ĐỘT BIẾN GEN BETA-GLOBIN€¦ · Sơđồquy trình phát hiệnđộtbiếngen β-globin Bệnh nhân β-thalassemia Thu thập mẫu máu và tách DNA Phát hiện đột

PBL Gen Globin Pasca

1 Genetics and Biosynthesis of Human Hemoglobin The α-like globin genes The β-like genes

Editing an α-globin enhancer in primary human ...repositorio.insa.pt/bitstream/10400.18/4791/1/Mettananda S et al... · ARTICLE Editing an α-globin enhancer in primary human hematopoietic

-globin ( 141) and -globin (146) V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS--H---GSAQVKGHGKKVADAL VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAF

Inhaltkempf.dcb.unibe.ch/StudentWork/2009/Studenten/120509.pdf · • KomplexeKopf‐Schwanz Struktur ... (contaminated polio vaccines) ... SV40 (Simian virus 40) Late transcripts

Hemoglobin (Hb) Hb is found in RBCs its main function is to transport O 2 to tissues. Structure: 2 parts : heme + globin Globin: four globin chains (2

Bacterial Expression vector Introduction Expression of cloned genes in Escherichia coli Expression of cloned genes in other bacteria Conclusion

Hb Famagusta analysis of a novel δ-globin chain variant ...€¦ · LETTERTO THE EDITOR Hb Famagusta—analysis of a novel δ-globin chain variant [HBD:c.60C>A] in four families

α-Amanitin insensitive transcription of the human η-globin gene

Dr. Hauke Holtorf / LS Stuttgart DNA-Mustererkennung Am Beispiel verschiedener -Globin-Gene Bestimmung der Ähnlichkeit von -Globin-Genen verschiedener

Polyoma-Virusinfektion nach Nierentransplantation · - 70% bzw. 75% Homologie mit SV40 und JCV (-> PML) - Pathogenitätsfaktor: Genetische Heterogenität der Transkriptions-Kontrollregion?

Enhancementof Extracapsular Polysaccharide Synthesis ... · phenicolwerefromSigmaChemical Co., St. Louis, Mo. DNAsequencing.The2.5-kbSalI-EcoRIDNAfragmentof pROJ31 was cloned into

MluI 228 NotI 1521 1 CS-CDF-EG-PRE-RfAcPPT+CTS EF-1 GFP PRE RfA Cm attR1 ccdB attR2 R U5 BGH pA f1 ori SV40 pro/ori Zeo SV40 pA ColE1 ori Amp 1 Plasmid name: CS-CDF-EG-PRE-RfA Plasmid

The β-Globin LCR is Not Necessary for an Open Chromatin Structure or Developmentally Regulated Transcription of the Native Mouse β-Globin Locus Elliot