presentación de powerpoint · respuesta inmune: anticuerpos neutralizantes ic 50 (μg/ml)* vsv**...
TRANSCRIPT
![Page 1: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/1.jpg)
Concepción Casado. Unidad de Virología Molecular
Laboratorio de Referencia e Investigación en Retrovirus
Centro Nacional de Microbiología (ISCIII), Madrid
30 años de control de la
infección en ausencia de
tratamiento
GeSIDA 2019
![Page 2: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/2.jpg)
INTRODUCCION
TAR controla la infección por VIH-1.
No elimina la infección.
La viremia plasmática reaparece cuando se retira el tratamiento
Existencia de un reservorio de células latentemente infectadas.
.
Lusic et al, Nat Rev Microbiol, 2017
GeSIDA 2019
![Page 3: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/3.jpg)
INTRODUCCION
Células T de memoria larga vida media.
Impide la eliminación de la infección mediante las terapias
actuales.
Siliciano et al. Nature Medicine (2003)
GeSIDA 2019
![Page 4: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/4.jpg)
INTRODUCCION: Nuevas estrategias
Sadowski et al. Cellular and Molecular Life Sciences (2019)
GeSIDA 2019
![Page 5: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/5.jpg)
INTRODUCCION
Pacientes que controlan la infección naturalmente en ausencia de TAR
Gurdanasi et al. AIDS (2014)
GeSIDA 2019
![Page 6: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/6.jpg)
Control permanente de la patogénesis del
VIH-1 en controladores de élite excepcionales
(EEC)
Individuos:3 individuos infectados por VIH que no han recibido tratamientoantiretroviral seguidos clinicamente en el Centro Sanitario Sandoval:
- 30 años de infección- seguidos clinicamente durante mas de 20 años- con seguimiento virológico durante mas de 15 años.
En 2017 se obtuvieron 500 ml de sangre periférica para realizar unacaracterización profunda de
La respuesta inmune:- humoral- celular
El virus:- Cuantificación del reservorio viral- Análisis evolutivo de las poblaciones virales
GeSIDA 2019
![Page 7: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/7.jpg)
Datos epidemiológicos y clinicosClinical, epidemiological and host-genetic characteristics
EEC-3 EEC-9 EEC-56
Year of birth 1956 1957 1957
Sex Male Female Female
Race Caucasian Caucasian Caucasian
Estimated year of infectionª 1983±2 1986±2 1984±2
Year of HIV-1 diagnosis 1988 1992 1989
Age at diagnosis 32 35 32
Transmission routeb
IVDU IVDU IVDU
Remarks – HIV-1 negative child HIV-1 negative child
HCV coinfection 1996 1992 1993
Treatment RBV/IFNα (2008) Spontaneous clearance DAA (2017)
Genetic markers
CCR5 ∆32 rs333c
11 11 11
CCR2 V64I rs1799864c
11 11 11
HLA C rs9264942 c
22 22 22
HLA A 02:01, 02:05 02:01, 31:01 01:01, 02:01
HLA B 27:05, 58:01 39:01, 57:01 14:02, 57:01
Genetic Score 4 3 4
a Viral dating performed in the last sample and estimated according to (11).
b No further expositions after HIV-1 diagnosis
c "1" indicates the most frequent allele and "2" the mutant.
IVDU, intravenous drug user; RBV, ribavirin; IFNα, interferon α, DAA, direct acting antivirals
GeSIDA 2019
![Page 8: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/8.jpg)
Factores genéticos del huesped
Clinical, epidemiological and host-genetic characteristics
EEC-3 EEC-9 EEC-56
Year of birth 1956 1957 1957
Sex Male Female Female
Race Caucasian Caucasian Caucasian
Estimated year of infectionª 1983±2 1986±2 1984±2
Year of HIV-1 diagnosis 1988 1992 1989
Age at diagnosis 32 35 32
Transmission routeb
IVDU IVDU IVDU
Remarks – HIV-1 negative child HIV-1 negative child
HCV coinfection 1996 1992 1993
Treatment RBV/IFNα (2008) Spontaneous clearance DAA (2017)
Genetic markers
CCR5 ∆32 rs333c
11 11 11
CCR2 V64I rs1799864c
11 11 11
HLA C rs9264942 c
22 22 22
HLA A 02:01, 02:05 02:01, 31:01 01:01, 02:01
HLA B 27:05, 58:01 39:01, 57:01 14:02, 57:01
Genetic Score 4 3 4
a Viral dating performed in the last sample and estimated according to (11).
b No further expositions after HIV-1 diagnosis
c "1" indicates the most frequent allele and "2" the mutant.
IVDU, intravenous drug user; RBV, ribavirin; IFNα, interferon α, DAA, direct acting antivirals
Clinical, epidemiological and host-genetic characteristics
EEC-3 EEC-9 EEC-56
Year of birth 1956 1957 1957
Sex Male Female Female
Race Caucasian Caucasian Caucasian
Estimated year of infectionª 1983±2 1986±2 1984±2
Year of HIV-1 diagnosis 1988 1992 1989
Age at diagnosis 32 35 32
Transmission routeb
IVDU IVDU IVDU
Remarks – HIV-1 negative child HIV-1 negative child
HCV coinfection 1996 1992 1993
Treatment RBV/IFNα (2008) Spontaneous clearance DAA (2017)
Genetic markers
CCR5 ∆32 rs333c
11 11 11
CCR2 V64I rs1799864c
11 11 11
HLA C rs9264942 c
22 22 22
HLA A 02:01, 02:05 02:01, 31:01 01:01, 02:01
HLA B 27:05, 58:01 39:01, 57:01 14:02, 57:01
Genetic Score 4 3 4
a Viral dating performed in the last sample and estimated according to (11).
b No further expositions after HIV-1 diagnosis
c "1" indicates the most frequent allele and "2" the mutant.
IVDU, intravenous drug user; RBV, ribavirin; IFNα, interferon α, DAA, direct acting antivirals
"1" indicates the most frequent allele and "2" the mutant.
GeSIDA 2019
![Page 9: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/9.jpg)
RESPUESTA INMUNE: Respuesta humoral
gp160gp120
p66p55
gp41
p31
p24
p17
Serum
Control
OR OR OR OROR#3 #9 #56
SP
CW
PC #12 #60
HIV-1 Western-blot reactivities
O: old sample, R: recent sample
SPC: strong positive control. WPC: weak positive
control
EEC CONTROLS
Plasma antibody titers
GeSIDA 2019
![Page 10: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/10.jpg)
RESPUESTA INMUNE: Anticuerpos neutralizantes
IC50 (μg/ml)*
VSV** NL4-3a AC10a VI 191a 92BR025a CM244a 92UG024a
Subtype B Subtype B Subtype A Subtype C Subtype AE Subtype D
Tier 1A Tier 2 Tier 2 Tier 1B Tier 2 Tier 2
Patient Date X4 R5 R5 R5 R5 X4
EEC 32003 ≥100 80 ≥100 ≥100 30 ≥100 ≥100
2017 ≥100 ≥100 ≥100 ≥100 ≥100 ≥100 ≥100
EEC 9 2002 ≥100 8 ≥100 ≥100 30 ≥100 ≥100
2017 ≥100 50 ≥100 90 ≥100 ≥100 ≥100
EEC 561998 ≥100 70 ≥100 ≥100 ≥100 ≥100 ≥100
2017 ≥100 70 ≥100 ≥100 ≥100 ≥100 ≥100
Purified IgGs IC50 neutralization profile against a mini panel of recombinant viruses from different
subtypes. Neutralization levels are indicated as follows: orange square < 10 µgr/ml purified IgG, yellow
11 – 99 µgr/ml purified IgG and white ≥100 µgr/ml of purified IgG.
GeSIDA 2019
![Page 11: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/11.jpg)
RESPUETA IMMUNE: Linfocitos T CD8+
CD8+ T-cell Gag-specific response from EEC and HIV-1-infected individuals on suppressive ART (ART):
A) Total CD8+ T-cell, B) Central Memory CD8+ T-cell, C) Effector Memory CD8+ T-cell and Terminally
Differentiated CD8+ T-cell.
A
B C D
GeSIDA 2019
![Page 12: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/12.jpg)
IMMUNE RESPONSE: Linfocitos T CD8+
INDEX of Polyfuncionality (pINDEX) of Gag-specific total CD8+ T-cells from EEC and HIV-1-infected
individuals on ART based on the proportions of cells producing intracelular combinations of IFN-γ,
TNF-α, IL-2 (A) plus CD107a 4 functions (B), and plus perforin 5 functions (C)
A
BC
GeSIDA 2019
![Page 13: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/13.jpg)
RESPUESTA INMUNE: Inhibición viral
por células T CD8+
Assay of the ex vivo ability of CD8+ T cells to inhibit superinfected autologous CD4+ T cells. The figure
shows day 7 of an infection with laboratory viral strain (A) HIV-1NFN-NX (CRR5-tropic) and (B) HIV-1NL4-3
(CXCR4-tropic). Percentage of inhibition of CD4+ vs CD4+CD8+ T cells is indicated.
GeSIDA 2019
![Page 14: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/14.jpg)
RESPUESTA INMUNE: Inmunidad innata
Total myeloid dendritic cell (A), myeloid dendritic subset CD1c+ (B) and myeloid dendritic subset CD141+ (C)
comparing EEC individuals with HIV-1-infected individuals on ART and non-HIV-1-infected healthy donors (HD).
A
B C
GeSIDA 2019
![Page 15: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/15.jpg)
RESPUESTA INMUNE: Inflamación
Inflammatory markers: hsPCR (A), β2-macroglobulin (B), D-dimer (C), IL-6 (D) and sCD163 (E). EEC individuals
were compared with HIV-1-infected individuals on ART and non-HIV-1-infected healthy donors (HD)
A B C
D E
GeSIDA 2019
![Page 16: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/16.jpg)
VIRUS: Reservorio viral
Viral measurements of (A) total HIV-1 DNA, (B) Infectious Units per million cells (IUPM), (C) ultrasensitive plasma viral
load and (D) cell associated HIV-1 RNA.
Open sybmbols indicate undetectable values. Light grey bands are the interquartile range from standard HIV-1
infected individuals on ART
A B C D
GeSIDA 2019
![Page 17: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/17.jpg)
PCR PATIENT DNA gag env env C2-V5 A B C D127 EEC 3CD4+ 310 ng + + + + + + ND COMPLETE153 EEC 3CD4+ 310 ng + - - - - - - ∆158 EEC 3CD4+ 310 ng + + + - - - + ∆164 EEC 3CD4+ 310 ng + - + - - - - ∆167 EEC 3CD4+ 310 ng + - + - - - - ∆168 EEC 3CD4+ 310 ng + - + - - - - ∆227 EEC 3CD4+ 310 ng + - - - - - - ∆238 EEC 3CD4+ 310 ng - - + - - - - ∆241 EEC 3CD4+ 310 ng - + + - - - - ∆
260 EEC 9 CD4+ 300 ng + - - +∆ +∆ +∆ +∆ ∆
184 EEC 56 CD4+ 365 ng + - - +∆ +∆ - +∆ ∆
VIRUS: Amplificación genomas completos
Full-genome sequencing strategy
Bruner et al. Nature Medicine 2016
GeSIDA 2019
![Page 18: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/18.jpg)
VIRUS: Amplificación genomas completos
Mueller et al. Viruses (2016)
Structure for the splice donor (SD) región in the HIV-1 leader RNA
G289A
5´SD cleavage site
GeSIDA 2019
![Page 19: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/19.jpg)
VIRUS: Amplificación genomas completos
Gag amino acid sequences obtained from EEC patients. Epitopes restricted by HLA-B*57 and HLA-B*27 are indicated
10 20 30 40 50 60 70 80 90 100 110 120
....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|
CONSENSUS_B MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEVKDTKEALEKIEEEQNKSKKKAQQAAA
EEC 3 127GAG ..............K...................................................A.......................K.............................
EEC 9 260GAG ..............K...................................................A........K..............K.............................
EEC 56 184GAG -----.........K..............R............................................................K.............................
130 140 150 160 170 180 190 200 210 220 230 240
....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|
CONSENSUS_B DTGNSSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTT
EEC 3 127GAG ..R..............I......................................................................................................
EEC 9 260GAG ..R..............I.......PL.............................................................................................
EEC 56 184GAG ..R..............I......................................................................................................
250 260 270 280 290 300 310 320 330 340 350 360
....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|
CONSENSUS_B STLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKA
EEC 3 127GAG ...P...................................S................................................................................
EEC_9 260GAG .N.....................................S................................................................................
EEC 56 184GAG .......................................S................................................................................
370 380 390 400 410 420 430 440 450 460 470
....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....
CONSENSUS_B RVLAEAMSQVTNS-ATIMMQRGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGEETTTPS
EEC 3 127GAG ...........S.-...............I.............R.....K...............................Y................................
EEC 9 260GAG ...........S.T...............I.......R...........................................P................................
EEC 56 184GAG ...........S.-...............I.............R.....................................Y................................
IK9
KF11
QW9
IW9
KK10 TW10
GeSIDA 2019
![Page 20: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/20.jpg)
VIRUS: Evolución intrapacienteGeSIDA 2019
![Page 21: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/21.jpg)
VIRUS: Reconstrucción filogenética en C2-V5 env
HXB289ES061
0.01
2003/02
2003/10
2004/04
2005/01
2007/01
2009/02
2017/03
99
78
79
93
EEC 3
99
99
97
94
72
89ES061
HXB2
0.01
EEC 9
EEC 56
2004/01
1998/06
1999/02
2000/02
2001/07
2002/04
2004/11
2005/06
2010/02
2013/05
Phylogenetic trees with C2-V5 env gene sequences of the individuals during follow-up.
HIV-1+ 2013/10
GeSIDA 2019
![Page 22: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/22.jpg)
VIRUS: Vabilidad genética en C2-V5 env
ART LTNP EC EEC
Genetic variability analysis of samples from different groups of HIV-1 individuals with a controlled infection
GeSIDA 2019
![Page 23: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/23.jpg)
Consecuencias de la baja heterogeneidad y tamaño de población: trinquete de Muller.
• En genética evolutiva se conoce por trinquete de Mulleral proceso por el cual los genomas de una poblaciónasexual acumulan mutaciones perjudiciales de formairreversible:
En virus ARN (incluido el VIH-1)se ha comprobado que enpoblaciones virales sometidas apases seriados en pequeñostamaños de población (cuellosde botella) se produce unairreversible pérdida de eficaciabiológica debida a laacumulación de mutacionesdeletéreas (Yuste et al, J. Virol,1999).
Schematic representation of the derivation of HIV-1
clones and of serial plaque-to-plaque transfers.
GeSIDA 2019
![Page 24: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/24.jpg)
• En el caso de los pacientesEEC probablemente elpequeño tamaño de lapoblación viral ha facilitadola pérdida de eficaciabiológica del virus (G7).
• De tal modo que aunquesiga existiendo algún virusno defectivo en elorganismo de estosindividuos, probablementela extremada baja diversidaddetectada no permitirá unarecuperación de la eficaciabiológica (G1p31).
Lorenzo-Redondo (2011). PhD Thesis. Universidad Autónoma de Madrid
Consecuencias de la baja heterogeneidad y tamaño de población GeSIDA 2019
![Page 25: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/25.jpg)
Resumen
• Los 3 pacientes muestras factores genéticos protectoresfrente a la infección.
• A pesar de los 30 años de infección los individuosmantienen una respuesta inmune potente y amplia.
• El reservorio viral es extremadamente pequeño y en sumayor parte defectivo.
• La variabilidad genética de las poblaciones virales esextremadamente baja.
• No se detecta evolución en los virus obtenidos de los 3individuos analizados.
GeSIDA 2019
![Page 26: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/26.jpg)
Conclusiones del estudio
• Estos pacientes EEC deberían ser considerados casosde cura funcional espontanea del VIH-1.
• Los pacientes EEC se distinguen de otros EC por subaja diversidad genética y por la ausencia deevolución viral a lo largo de la infección.
• Los datos obtenidos indican que las estrategiasencaminadas a una cura funcional deben dirigirse nosolo a la reducción del reservorio viral sino tambiénhacia el mantenimiento de una diversidad genéticaviral extremadamente baja y una respuesta inmuneespecífica potente.
GeSIDA 2019
![Page 27: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/27.jpg)
Centro Sanitario SandovalHospital Clínico San Carlos. IdISSC. Madrid
Carmen RodríguezMar VeraJorge del Romero
María Pernas Isabel Olivares Rosa FuentesCecilio López GalíndezConcepción Casado
Unidad de Virología MolecularLaboratorio de Referencia e Investigación en Retrovirus CNM-ISCIII, Madrid.
Cristina Gálvez Maria SalgadoJavier Martínez-Picado
Institut de Recerca de la Sida IrsiCaixaHospital German Trias i Pujol. Badalona
Laura Tarancón-Diez Rebeca de Pablo-BernalEzequiel Ruiz-Mateos
Unidad Clinica de Enfermedades Infecciosas, Microbiologia y Medicina Preventiva.Instituto de Biomedicina de Sevilla (IBiS) Hospital Virgen del Rocío, Sevilla.
Alberto Merino-MansillaVictor Sánchez-Merino
Unidad de Inmunopatología del SIDA Laboratorio de Referencia e Investigación en Retrovirus CNM-ISCIII, Madrid.
Ramón Lorenzo-RedondoDivision of Infectious Diseases, Northwestern University Feinberg School of Medicine, Chicago
GeSIDA 2019
![Page 28: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/28.jpg)
Spanish HIV/AIDS Research Network
Financiación GeSIDA 2019
![Page 29: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/29.jpg)
GeSIDA 2019
![Page 30: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/30.jpg)
INTRODUCCION
Se han propuesto dos estrategias de curación para el VIH-1:
Cura esterilizante: que implica la total erradicación delvirus del paciente.
Solo dos casos:
Paciente de Berlín (2011) y el paciente de Londres
(2019).
Trasplante de progenitores hematopoyéticos resistentes
a la infección (CCR5 ∆32)
Cura funcional: que implica la supresión permanente de
la replicación viral en ausencia de tratamiento.
GeSIDA 2019
![Page 31: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/31.jpg)
¿Son estos pacientes realmente tan excepcionales?
¿Podríamos identificar otros pacientes con características similares?
VIRUS: Variabilidad genética en C2-V5 env
Estimates of average evolutionary diversity over sequence pairs within individual and time point
PATIENTS
López-Galíndez et al. Current Opinion in Virology, 2019
GeSIDA 2019
![Page 32: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/32.jpg)
10 20 30 40 50 60 70 80 90 100 110 120
....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|
EEC 3 2005 MGARASVLSGGELDKWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPALQTGSEELRSLYNTVATLYCVHQKIEVKDTKEALEKIEEEQNKSKKKAQQAXA
V
A
ECC 3 2017 ......................................................................................................................A.
130 140 150 160 170 180 190 200 210 220 230 240
....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|
EEC 3 2005 DTRNSSQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTT
ECC_3_2017 ........................................................................................................................
250 260 270 280 290 300 310 320 330 340 350 360
....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|
EEC_3_2005 STLXEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPSSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKA
Q
P
ECC_3_2017 ...P....................................................................................................................
370 380 390 400 410 420 430 440 450 460 470
....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|...
ECC 3 2005 RVLAEAMSQVTSSATIMMQRGNFRNQRKIVKCFNCGKEGHIARNCRAPKKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEESFRFGEETTTPS
ECC_3_2017 .................................................................................................................
Gag amino acid sequences obtained from EEC 3 in 2005 and 2017
10 20 30 40 50 60 70 80 90 100 110 120
....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|..
EEC 3 2005 GGaAACCAGAGGAGCTCTCTCGACGCAGGACTCGGCTTGCTGAaGCGCGCACGGCAAGAGGCGAGgGgcGGCGACTGXTGAGTACGCCAAAATTTTGACTAGCGGAGGCTAGAAGGAGAGAG
G
A
EEC 3 2017 .............................................................................A............................................
SD region nucleotide sequences obtained from EEC 3 in 2005 and 2017
VIRUS: Comparación de secuencias virales obtenidas en los años 2005 y 2017GeSIDA 2019
![Page 33: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/33.jpg)
GeSIDA 2019
![Page 34: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/34.jpg)
GeSIDA 2019
![Page 35: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/35.jpg)
GeSIDA 2019
![Page 36: Presentación de PowerPoint · RESPUESTA INMUNE: Anticuerpos neutralizantes IC 50 (μg/ml)* VSV** NL4-3a AC10 aVI 191 92BR025 aCM244 92UG024a Subtype B Subtype B Subtype A Subtype](https://reader031.vdocuments.pub/reader031/viewer/2022011816/5e6dc0656f747c23ba1b05c8/html5/thumbnails/36.jpg)
GeSIDA 2019