Kap. 6

Vývojové procesy určované

polohou ve vztahu k určité

buňce, pletivu či orgánu

(Origins of periodic patterns)

Ekvivalentní a neekvivalentní buňkyu živočichů a rostlin

• laterální (bočná) specifikace(vymezení)

• indukce

Trichome differentiation

Trichom-

Entwicklung

Arabidopsis

thaliana

glabrous (glabra?) mutants

GL2 transcription pattern

wt

gl

(GL3)

TTG1•The protein is mapped to the

transparent testa glabra1 locus.

•This locus regulates several

developmental and biochemical

pathways in Arabidopsis, including

the formation of hairs on leaves,

stems, and roots, and the production

of seed mucilage and anthocyanin

pigments (purple coloured seedlings).

•This protein is similar to AN11, a

regulator of anthocyanin biosynthesis

in petunia, and is more distantly

related to those of the β-subunits of

heterotrimeric G proteins, which

suggests a role for TTG1 in signal

transduction to downstream

transcription factors.

TTG1

• FUNCTION – it may regulate MYC transcription factors involved in trichome and root hair development, seed mucilage production, and anthocyanin biosynthesis by acting at the dihydorflavonol-4- reductase (DFR) step or it may regulate pathways that involve MYC factors

• SUBCELLULAR LOCATION - cytoplasmic.

• TISSUE SPECIFICITY - Roots, leaves, stems, meristems, flowers and flower buds.

• SIMILARITY - Contains 4 WD40 repeats (Proteins containing WD40 repeats are involved in a number of different types of regulatory roles, such as signalling, cell cycle regulation, transcriptional repression, vesicular trafficking and RNA processing)

Post Translational Modifications

Predicted by PROSITEMDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLRSSSGHRIAVGSFLEDYNNRIDILSFDSDSMTVKPLPNLSFEHPYPPTKLMFSPPSLRRPSSGDLLASSGDFLRLWEINEDSSTVEPISVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWDIEKSVVETQLIAHDKEVHDIAWGEARVFASVSADGSVRIFDLRDKEHSTIIYESPQPDTPLLRLAWNKQDLRYMATILMDSNKVVILDIRSPTMPVAELERHQASVNAIAWAPQSCKHICSGGDDTQALIWELPTVAGPNGIDPMSVYSAGSEINQLQWSSSQPDWIGIAFANKMQLLRV

• N-glycosylation sites

• tyrosine sulphate site

• cAMP- and cGMP- dependent protein kinase phosphorylation sites

• protein kinase C phosphorylation sites

• casein kinase II phosphorylation sites

• N-myristoylation sites in bold

• WD repeats region is underlined

Microarray analysis

• Shown to be highly expressed in two microarray experiments.

• Growth conditions caused TTG1 overexpression

– Normal light, darkness and then far red light

Summary

• Arabidopsis thaliana transparent testa glabra 1 protein (TTG1)

• Encodes a protein of 341 amino acids localised to chromosome 5p and consists of 3 exons

• TTG1 protein does not act directly as a transcription factor but binds to other proteins to promote the initiation of trichomes in leaves and stems, it is also involved in regulating the transcription factors involved in seed mucilage production and anthocyanin biosynthesis.

GLABRA1

• transcription factor – MYB related

• bHLH, MYB interactor

GL3 … and maize R

Triptychon (TRY)

• MYB-related

• inhibits trichome

differentiation

• mutant - clusters

Alan TURING

1912-1954

1951-2 - Reakčně-difusní model

Root hair differentiation

GL2 brání růstu vlášení na pozici

atrichoblastů

GL2 = homeodomain txn factor

GL2 exprese

• Photograph of wild-

type (left), ttg mutant

(center), and wer

mutant (right) roots

bearing the

GL2::GUS

transgene. Note that

ttg and wer

dramatically reduce

GL2 gene

expression.

(Schiefelbein lab)

WER: standardní MYB

CPC: MYB bez transaktivace

CPC se ovšem exprimuje

přednostně v atrichoblastech

působí buněčně neautonomně –

transportuje se jako „aktivátor“ trichoblastů

do sousedních buněk trichoblastů

Patterning of stomata

Vasculature patterning

reakčně-difusní model

(http://texturegarden.com/)

Phyllotaxis

Alan TURING

1912-1954

1951? – nepublikovaná teorie

fylotaxe

1941 discusses daisy patterns & fir cones with

Joan Clarke

1947-1948 attends Cambridge undergraduate

physiology lectures

Feb 1951 Manchester Mark I machine installed

Nov 1951 paper on the ‘simple case’ - ‘Chemical basis

of morphogenesis’

1952 ‘Had quite a jolly time lecturing on fir

cones’

1952-1954 Drafts part of the Morphogen Theory of

Phyllotaxis, finally published in 1992.

Jonathan Swinton 2004. See http://www.swintons.net/jonathan/Turing/

Morphogenesis: Collected Works of AM Turing, Volume 3,

ed PT Saunders, North-Holland, 1992. This contains:

•An introduction by Saunders

•A reprint of The chemical basis of morphogenesis

•A diffusion-reaction theory of morphogenesis in plants

•The morphogen theory of phyllotaxis I

•The morphogen theory of phyllotaxis II

•Outline of the development of the daisy

‘my mathematical theory of embryology...is yielding to treatment, and it will so far as I can see, give satisfactory explanations of

(i) gastrulation

(ii) polygonally symmetrical structures, e.g. starfish, flowers

(iii) leaf arrangements, in particular the way the Fibonacci series (0,1,1,2,3,5,8,13,...) comes to be involved

(iv) colour patterns on some animals, e.g. stripes, spots and dappling

(v) pattern on nearly spherical structures such as some Radiolara...’

A. Turing, 8th Feb 1951

Fylotaxe a Fibonacciho posloupnosti

Turing archive Church, 1904

Dějiny fylotaxe - počátky

• 370-285 BC Theophrastus – pravidelné uspořádání listů

• 1202 Leonardo Fibonacci – Fibonacciho posloupnost <1, 1, 2, 3, 5, ... F(k), F(k+1)> (mimo souvislost s fylotaxí)

• 1754 Charles Bonnet – popis fylotaktic. spirál v moderním smyslu

• 1830-35 Schimper a Braun – formalizace popisu; od té doby pokusy o matematické uchopení

• 1882 Julius Sachs odmítá matematic. modely

• ... ale modelování pokračuje ... i pokusy

D´Arcy Wenworth

Thompson

1860-1948

1917 – On Growth and Form

Stems, cones and flowers

8 green

parastichies

13 red

parastichies

Church, 1904

This presentation is copyright Jonathan Swinton 2004. See http://www.swintons.net/jonathan/Turing/TuringCopyright.html for details and copyright owners of the images contained.

Experiment Douadyho a Coudera

(1992)

Drops of ferrofluids are deposited periodically at

the center of a circular dish filled with silicon oil.

Under the effect of magnets surrounding the dish,

the drops repel one another and are attracted to the

edge of the dish. To Douady and Couder’s own

amazement, when the magnetic field was slowly

reduced during the process, the drops self-organized

into Fibonacci phyllotactic patterns.

„Realistický“ model fylotaxe

Pattern generation by the transport-based model. (A–D)

Pattern emergence in a sequence of 50 cells with

wraparound boundary conditions (the leftmost and the

rightmost cell are considered neighbors). Taller bars

(brighter green) indicate higher IAA concentration.

Simulation steps 30, 60, 70, and 80 are shown. A small

amount of noise is required to break symmetry. (E and F)

Pattern dependence on model parameters. Higher values of

the transport coefficient result in more peaks (G) Pattern

formed in a simulated cellular structure. PIN1 is depicted in

red.

(R.S. Smith et al., PNAS 2006)

Shrnutí

• Specifikace typů buněk (pletiv, orgánů) v rámci rostlinného organismu je dána neustále probíhající vzájemnou signalizací-ovlivňováním vyvíjejících/diferencujících se buněk, pletiv a orgánů, které si tak vzájemně poskytují poziční informaci.

• Takové procesy jsou charakterizovány opakovanými zpětnovazebnými cykly, které amplifikují malé počáteční rozdíly. Vzájemná komunikace umožňuje pozdější úpravu počátečních odchylek od pravidelného uspořádání.

• Typickým jevem je repetitivní pravidelnost, kterou lze modelovat

Soběpodobnost a algoritmická

povaha rostlinného těla

• aneb k čemu jsou vizuální modely

J.W. Goethe o algoritmické povaze

rostliny

Vorwärts und rückwärts ist die Pflanze immer

nur Blatt.17.5.1787

Es mag nun die Pflanze sprossen, blühen oder

Früchte bringen, so sind es doch nur immer

dieselbiger Organe, welche in vielfältigen

Bestimmungen und unter oft veränderten

Gestalten die Vorschrift der Natur erfüllen.1790

Aristid

Lindenmayer

1925-1989

1968 - Mathematical models for

cellular interaction in development.

http://algorithmicbotany.org/

„Náhodný“ pseudorealismus ...

Ještě jednou fylotaxe ...

(pravidelnost není na škodu)

Fylotaxe – kolizní model

Architektura bylin

(jak zapracovat signály)

Šíření signálů rostlinou

• Akropetální kvetení

• Basipetální kvetení

• Architektura Mycelis

muralis – schématická

a „realistická“

Modelování orgánů

Cellular L-systems

Přidejme spojitý čas ...

• Složený list

• Apex – Ailanthus

• Kvetení – zvonek

Rostliny v prostředí

(cestou k ekosystému)

Interakce s prostředím

• Klonální jetel a světlo

• Kompetice větví o

světlo

• Kořen a voda v půdě

…anebo?

• P.Prusinkiewicz: modelování vývojových

mutantů, model fylotaxe uvažující

relokalizaci PIN (PNAS 2006)

• O.Leyser + P.Prusinkiewicz: identifikace

nového regulátoru dormance pupenů

(MAX)

• see e.g. Berleth et al. TiPS 2007