54

V. IDENTITY AND SEQUENCE DIVERSITY OF

BEGOMOVIRUS ASSOCIATED WITH YELLOW LEAF CURL DISEASE OF TOMATO IN INDONESIA*

)

Abstrak

Infeksi Begomovirus pada tanaman tomat menyebabkan penyakit yang

serius dan kehilangan hasil yang nyata. Tujuan penelitian ini adalah (i)

mengamplifikasi gen AV1 untuk Begomovirus menggunakan primer spefisik; (ii)

menentukan sekuen nukleotida dari gen AV1 hasil amplifikasi PCR; (iii)

mengidentifikasi virus-virus yang berasosiasi dengan penyakit keriting daun pada

tomat; dan (iv) menganalisis diversitas sekuen asam nukleat dan asam amino

prediksi dari gen AV1 di antara isolat-isolat yang diidentifikasi. Sampel-sampel

yang menunjukkan gejala-gejala umum dari infeksi Begomovirus dikoleksi dari

lokasi-lokasi yang berbeda di Jawa dan Sumatera. Amplifikasi polymerase chain

reaction (PCR) menggunakan asam nukleat total dan primer spesifik Begomovirus

untuk gen AV1, sekuensing secara langsung dari produk PCR, dan analisis sekuen

asam nukleat dan asam amino menggunakan BLAST telah dilakukan. Kesimpulan

dari penelitian ini adalah (i) adanya pita DNA hasil amplifikasi PCR

membuktikan bahwa sampel-sampel tanaman tomat yang sakit terinfeksi oleh

Begomovirus (ii) hasil analisis BLAST menggunakan sekuen nukleotida dan asam

amino menunjukkan bahwa fragmen DNA hasil amplifikasi PCR adalah gen AV1

dari Begomovirus, (iii) identitas sekuen nukleotida dan asam amino dari gen AV1

di antara isolat-isolat Begomovirus mengindikasikan bahwa isolat-isolat tersebut

adalah strain Ageratum yellow vein virus (AYVV) Indonesia, dan (iv) hasil

analisis filogenetik mengindikasikan bahwa delapan isolat Begomovirus tersebut

terbagi menjadi dua kelompok yang berbeda. Hasil dari percobaan ini juga

menggambarkan bahwa adanya keragaman genetik Begomovirus pada berbagai

daerah di Indonesia perlu untuk diteliti lebih lanjut. Selain itu, prevalensi dari

spesies Begomovirus yang berbeda perlu juga untuk diteliti.

Kata kunci: Begomovirus, analisis sekuen, gen AV1, Tomato leaf curl virus

*) Bagian dari disertasi ini telah diterbitkan dalam jurnal ilmiah terakreditasi

Microbiology Indonesia 2 (1): 1-7. April 2008

55

Abstract

Infection of Begomovirus in tomato has caused serious disease and yield

losses. The objectives of this study were to: (i) amplify putative AV1 gene using

AV1 specific primers for Begomovirus; (ii) determine nucleotide sequences of the

PCR amplified AV1 gene; (iii) identify the viruses associated with tomato leaf

curl disease; and (iv) analyze nucleic acid and predicted amino acid sequence

diversities of AV1 gene among the identified isolates. Samples of tomato plants

showing typical symptoms of Begomovirus infection were collected from

different locations in Java and Sumatera. Polymerase-chain reaction (PCR)

amplification using total nucleic acid isolated from sample plants and

Begomovirus specific primers for AV1 gene was performed; direct sequencing of

PCR product was carried out; and nucleotide and amino acid sequence analysis

using BLAST were conducted. The conclusions of this research were (i) positive

results of the PCR amplification proved that diseased tomato samples collected

from eight locations in Java and Sumatra were infected with at least one isolate of

Begomovirus, (ii) the Blast analysis results using nucleotide and amino acid

sequences showed that the PCR amplified DNA fragment was AV1 gene, (iii)

identity of nucleotide and amino acid sequences of AV1 gene among

Begomoviruses indicated that the isolates determined in this research were

Indonesian isolates of AYVV, and (iv) results of phylogenetic analysis of eight

Begomovirus isolates identified in this study indicated they belonged into two

different clades. Results of this research also suggest that the existence of

Begomovirus genetic diversity in various regions in Indonesia need further

investigation. Moreover, the prevalence of distinct Begomovirus species or

isolates should also be investigated.

Keywords: Begomovirus, sequence analysis , AV1 gene, tomato leaf curl virus

56

Introduction

The family Geminiviridae is one of the largest group of plant viruses. The

morphology of geminivirus particles is unique having a geminate shape and a

small size (≈ 30 x 20 nm). They are characterized by a circular, single stranded,

DNA genome which replicates in the host cell nucleus and is encapsidated in

twinned incomplete icosahedral particles. The family Geminiviridae is divided

into four genera, i.e. Mastrevirus, Curtovirus, Topocuvirus and Begomovirus,

based on the viral genome structure, host range and type of insect vector (Van

Regenmortel et al. 1999). Mastreviruses and Curtoviruses have a monopartite

genome and are transmitted by various leafhopper species, but infect

monocotyledonous and dicotyledonous plants, respectively. The genus

Topocuvirus is made up of the tomato pseudo-curly - top virus, which has a

monopartite genome, is transmitted by treehopper species, and which infects

dicotyledonous plants. Members of the genus Begomovirus have monopartite (one

~2.9-kb DNA) or bipartite (two ~2.6-kb DNAs referred to as “DNA-A” and

“DNA-B”) genome, is transmitted by whiteflies (e.g. Bemisia tabaci Gennadius)

and infects dicotyledonous plants (Harrison 1985).

Begomoviruses are considered to be emerging plant viruses, due to their

increasing incidence and the severity of the diseases which they cause in a number

of economically important crops, mostly in tropical and subtropical regions in the

world (Polston & Anderson 1997). In Indonesia, begomoviruses are currently

spreading threat for cultivated tomato in some tomato production areas and

causing substantial yield losses. These viruses have also been reported to infect

some other plants such as chilli pepper (Capsicum annuum L.), ageratum

(Ageratum conyzoides L.) and tobacco (Nicotiana benthamiana L.) (Sudiono et al.

2001).

Partial characterization of the genomic sequence of the Indonesia tomato-

leaf-curl virus (ToLCIDV) was first reported in 1999 (DDBJ, accession number

AF189018). Similar characterization was performed for six begomoviruses

infecting tomato plants from Bandung, West Java (ToBadI-5, ToBadII-20,

ToBadII-23, ToBadIII-1), Purwokerto, Central Java (ToPur-6), and Magelang,

57

Central Java (ToMag-2) (Sukamto et al. 2005). Meanwhile, the complete

nucleotide sequence identification has been reported for the tomato-leaf-curl Java

virus (Kon et al. 2006).

In this paper, we report sequence analysis of the coat protein gene isolated

from eight begomovirus isolates infecting tomato plants collected from different

location in Java and Sumatra. It is important to understand the genetic diversity of

begomoviruses infecting tomato plants as basic information for developing

disease control strategies.

Materials and Methods

Sample collection

Tomato plant showing typical symptoms of begomovirus infection

(yellow mosaic, leaf curling, and stunting) were collected from several tomato

producing areas (8 districts, 5 provinces) in Indonesia (Figure 13 and see

RESULTS Table 4). Samples were placed in plastic bags or bottles and carried to

the laboratory for DNA extraction and to screenhouse for virus isolation and

propagation in host plant.

DNA extraction and Polymerase Chain Reaction (PCR) analysis

Total DNA was extracted from leaf according to Doyle and Doyle (1990)

with slight modification. Leaf tissue was ground in a sterile mortar in 1.0 ml of

extraction buffer. The extraction buffer used for the initial homogenization

contains 100 mM Tris pH 8.0, 1.4 M NaCl, 20 mM EDTA pH 8.0, and 0.2% (v/v)

Β-mercaptoethanol. The extraction buffer was autoclaved and 2%

polyvinylpyrolidone (PVP) and 2% CTAB were added immediately before use.

Immediately after grinding, 500 µl aliquote were transferred to a 1.5 ml microfuge

tube and incubated for 15 min at 65oC with occasional mixing to avoid

aggregation of the homogenate. To the extract was added 500 µl of

chloroform:isoamylalcohol (24/1) and the mixture was vortexed thoroughly. Each

tube was then centrifuged for 15 min at 10.000 x g. The debris-free supernatant

was transferred to a new tube and proteins precipitated by adding 2.5 x volume of

absolute ethanol and washed twice with 70% ethanol (v/v). The pellet was dried

58

and resuspended in 100 µl of sterile distilled water. This DNA extract was stored

at -20oC for further use.

The coat protein gene was amplified by the PCR technique using two

oligonucleotide specific primers for the geminivirus coat protein gene that were

provided by Dr. Sylvia Green from the Asian Vegetable Research Development

Centre (AVRDC-Taiwan), i.e the CPPROTEIN-V1 (5’-

TAATTCTAGATGTCGAAGCGACCCGCCGA-3’) and the CPPROTEIN-C1

(5’-GGCCGAATTCTTAATTTTGAACAGAATCA-3’). PCR reactions were

prepared in 25 µl total volume, containing 10X buffer (100 mM Tris-HCl, 500

mM KCl, pH 8.3), MgCl2 (75 mM), dNTP mix (4 mM), 10 µM of each primer, 1

unit of Taq DNA polymerase and 2 µl of the DNA template. The amplication

profile consisted of 30 cycles of denaturation at 94oC for 1 min, primer annealing

at 55oC for 1 min and primer extension at 72

oC for 2 min and followed by

postextension at 72oC for 5 min. PCR products were analysed in agarose gels

(1%) and stained with ethidium bromide and visualized under UV light using the

Chemidoc gel system (Biorad).

Direct sequencing of PCR products

Products of the PCR were first visualized in agarose gels (1%) to estimate

concentration and to confirm purity. Further purification of PCR products used

ExoISAP digestion [Exonuclease I enzyme and Shrimp Alkaline

Phosphatase/SAP (Biorad)] to remove the excess primers and dNTPs. The

purified PCR products were then diluted, and mixed with a single primer (either

forward or reverse primer). Each sequencing reaction was prepared using a DTCS

kit (Beckman Coulter) in a 20 µl volume containing 1,5 µM of either forward or

reverse primer and 50 ng of template DNA. The reaction profile consisted of 45

cycles of denaturation at 96oC for 20 sec, primer annealing at 50

oC for 20 sec and

primer extension at 60oC for 4 min. Reactions were analyzed in an CEQ 800

analyzer (Beckman Coulter).

Determination of Virus Identity

Database searches for the selected begomoviruses species were carried out

using The National Center of Biotechnology Information basic local alignment

59

search tool or NCBI BLAST(http://www.ncbi.nlm.nih.gov/BLAST) (Altschul et

al. 1990). The identity of the virus was determined based on the highest

percentage value of the AV1 gene nucleic acid and amino acid sequence among

the evaluated isolates and available sequences in the GenBank DNA database.

The sequences were aligned using ClustalW (Thompson et al. 1994) while

phylogenetic analysis was conducted using online tool facilities available at

http://www.genebee.msu.su/clustal/advanced. html. The distance matrices were

calculated using the Kimura two-parameters model (Kimura 1980). Results of the

analysis were used to construct phylogenetic tree and the robustness of the

internal branches of the tree was estimated by bootstrap analysis using 1000

replicates

a b

c d

Figure 13 Tomato plants exhibited various leaf-curl symptoms. Subsequent experiment

indicated they were infected by Begomoviruses. (a) Leaf curling, smaller

leaflet and stunting symptoms on tomato from Bogor, West java, (b) Leaf

curling and mosaic symptoms on tomato from Sragen, Central Java, (c) Severe upward leaf curling and yellowing symptoms on tomato from

Kaliurang, DI Yogyakarta, and d) Leaf curling symptom on tomato from

Blitar, East Java.

60

Results

PCR Amplification of AV1 gene

The detection of begomovirus infection using specific primers for AV1

gene specific primers was resulted in a single DNA fragment of approximately

780 bp (Figure 14) for most of the tomato plants showing typical begomovirus

symptoms collected from the eight locations (Figure 13). Since the

oligonucleotide primers used for PCR were specific for amplifying coat protein

(AV1) gene of Begomovirus, results of this research suggested the presence of

Begomovirus in all collected tomato plants.

Direct sequencing of PCR products

Direct sequencing of PCR products generated sequences of the putative

AV1 gene ranged from 529 – 707 bp (Table 4). The determined nucleotide

sequences would be submitted to GenBank Database. Homology among

begomovirus isolates was shown when alignment was performed for predicted

amino acid sequence of partial AV1 gene of eight Begomovirus isolates identified

in this research and other isolates available in the GenBank DNA database (Figure

15).

1 0 0 0 -b p

8 5 0

6 5 0

A V 1 g e n e

Figure 14 Agarose gel electropherogram of polymerase chain reaction (PCR)

amplified DNA fragments of putative AV1. The DNA fragments were

amplified by PCR using AV1 specific primers and total nucleic acid

of diseased tomato sample from (1) Malang, East Java; (2) Blitar, East

Java; (3) Sragen, Central Java; (4) Magelang, Central Java; (5)

Boyolali, Central Java; (6) Kaliurang, DI Yogyakarta; (7) Bogor,

West Java; and (8) Brastagi, North Sumatera. Marker: 1 Kb plus

(Invitrogen) DNA marker.

1 2 3 4 5 6 7 8 M

61

Table 4 Isolate identity, observed symptoms on collected tomato samples, location

of collected samples, and number of determined nucleic acid and

predicted amino acid sequences based on the polymerase chain reaction

amplified putative AV1 gene.

Size of sequences Isolate

identity

Observed symptoms on

collected tomato sample

Location of

collected sample Nucleotide

(bp)

Amino acid

(residues)*

ToLC-Blt Leaf curling and

stunting

Blitar, E. Java 580 193

ToLC-Mlg Yellowing, severe

upward leaf curling, and

stunting

Malang, E. Java 529 176

ToLC-Srg Leaf curling, stunting and mosaic

Sragen, C. Java 685 227

ToLC-Mgl Leaf curling, stunting

and smaller leaflet

Magelang, C. Java 707 235

ToLC-Byl Leaf curling and

stunting

Boyolali, C. Java 702 233

ToLC-Klu Severe upward leaf

curling, yellowing, and

stunting

Kaliurang, DI.

Yogyakarta

605 201

ToLC-Bgr Severe leaf curling,

cupping, smaller leaf,

and stunting

Bogor, W. Java 666 221

ToLC-Btg Leaf curling and

stunting

Brastagi, N.

Sumatra 706 234

Note: * Predicted based on the determined nucleotide sequences.

Determination of Virus Identity

Comparison of nucleotide and predicted amino sequences of putative AV1

gene of the eight isolates with available AV1 gene sequences in the GenBank

revealed that the eight isolates had homologies above 90% with Ageratum yellow

vein virus isolate from Singapore (AYVV – GenBank acc. no. X74516) (Tan et al.

1995). The homology was less than 90% with Pepper leaf curl virus isolate from

Malaysia (PepLCV-Mal –AF414287) (Shih et al. 1998) or Cassava mosaic virus

isolate from South Africa (CasMV-SA –AJ575560) (Briddon et al. 2003) (Table

5).

62

ToLC-Btg VLVTNKRRTWTNRPMYRKPRLYRMYRTPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD

ToLC_Srg VLVTNKRRTWTNRPMYRKPRLYRMYRTPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD

ToLC_Bgr VLVTNKRRTWTNRPMYRKPRLYRMYRTPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD

ToLC_Mlg VLVTNKRRTWTNRPMYRKPRLYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD

ToLC-Blt VLVTNKRRTWTNRPMYRKPRLYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD

ToLC-Klu VLVTNKRRTWTNRPMYRKPRLYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVCCVTD

ToLC-Byl VFVTNKRRTWTNRPMYRKPSMYSMYRSPDVPKGCEGPCNVQSYEQRHDISHVGKVLCVSD

ToLC_Mgl VLVTNKRRTWTNRPMYRKPRLYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD

AYVV VLVTNRRRTWTNRPMYRKPRLYRMYRTPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD

SCLV-Jpn VLVTNKRRTWTNRPMYRKPRMYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD

ToLCV_Mal VLVTNKRRAWTQRPMYRKPRMYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD

ToLCV_JvA VLVTNKRRTWTNRPMYRKPRLYRMYRSPDVPKGCEGPCKVQSFESRHDVSHVGKVCCITD

ToLCV-Jv VLVTNKRRTWTNRPMYRKPRMYRMYRSPDVPKGCEGPCKVQSFESRHDVSHVGKVCCITD

PepLCV-Mal VLVTNKRRSWANRPMNRKPRIYRMYKSPDVPRGCEGPCKVQSYEQRHDVAHVGKVICVSD

CasMV-SA VQGTNKRRSWTLRPMYRKPRMYRMYRSPDVPRGCEGPCKVQSYEQRDDVKHTGAVRCVSD

* **:**:*: *** *** :* **::****:******:***:*.*.*: *.* * *::*

ToLC-Btg VTRGNGLTHRVGKRFCVKSVYVLGKVWMDENIKTKNHTNTVMFYLVRDRRPYGT-AMDFG

ToLC_Srg VTRGNGLTHRVGKRFCVKSVYVLGKVWMDGDIKTKNHTNTVMFYLVRDRRPYGT-ALDFG

ToLC_Bgr VTRGNGLTHRVGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPYGT-AMDFG

ToLC_Mlg VTRGNGLTHRVGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPYGT-AMDFR

ToLC-Blt VTRGNGLTHRVGKRFCVKSVYMLGKIWMDENIKTKNHTNTVMFHLVRDRRPYGS-AMDFG

ToLC-Klu VTRGNGLTHRMGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPYGS-AMDFG

ToLC-Byl VTRGNGLTHRVGKRFCVRSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPYGS-AMDFG

ToLC_Mgl VTRGNGLTHRVGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPYGS-AMDFG

AYVV VTRGNGLTHRVGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPFGT-AMDFG

SCLV-Jpn VTRGNGLTHRVGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPFGT-AMDFG

ToLCV_Mal VTRGNGFTHRVGKRFCVKSIYVLGKIWMDENIKTKNHTNTVMFFLVRDRRPFGT-AMDFG

ToLCV_JvA VTRGLGLTHRTGKRFCVKSVYIMGKVWMDENIKTKNHTNTVMFFLVRDRRPYSS-PQDFG

ToLCV-Jv VTRGLGLTHRTGKRFCVKSVYIMGKVWMDENIKTKNHTNTVMFFLVRDRRPYSS-PQDFG

PepLCV-Mal VTRGNGLTHRVGKRFCIKSVYVLGKIWMDENIKTKNHTNTVMFFLVRDRRPFGT-PQDFG

CasMV-SA VTRGSGITHRVGKRFCVKSIYVLGKIWMDENIKKQNHTNQVMFFLVRDRRPYGTSPMDFG

**** *:*** *****::*:*::**:*** :**.:**** ***.*******:.: . **

ToLC-Btg QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYACKEQAMV

ToLC_Srg QVFNMYDNEPSTATIKNDLRDRYQVLRKFSSTVTGGQYACKRQAWV

ToLC_Bgr QVFNMYDNEPSTATIKNDLRDRYQVLRKYTSTVTGGQYACKEQALV

ToLC_Mlg QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYACKEQAWV

ToLC-Blt QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYAAKEQASV

ToLC-Klu QVFTMYDNEPSTATIKNDLRDRYQGVRKLSSTVTGGQYAGKGQASV

ToLC-Byl QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYASKEQALV

ToLC_Mgl QVYNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYASKEQALV

AYVV QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYASKEQALV

SCLV-Jpn QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYACKEQALV

ToLCV_Mal QVFNMYDNEPSTATVKNDMRDRYQVLRKFTATVTGGQYASKEQALV

ToLCV_JvA QVFNMYDNEPSTATVKNDMRDRFQVLRKFSSTVTGGQYACKEQALV

ToLCV-Jv QVFNMYDNEPSTATVKNDMRDRFQVLRKFTSTVTGGQYACKEQSLV

PepLCV-Mal QVFNMYDNEPSTATVKNDNRDRFQVLRRFQATVTGGQYASKEQAIV

CasMV-SA QVFNMFDNEPSTATIKNDLRDRFQVLRKFHATVVGGPSGMKEQALI

**:.*:********:*** ***:* :*: :**.** . * *: :

Figure 15 Alignment of partial amino acid sequences predicted from determine

nucleotide sequences of AV1 gene of eight Begomovirus isolates

determined in this research and seven Begomovirus isolates available

from GenBank DNA database. AYVV - Ageratum yellow vein virus

(X74516), SCLV-Jpn– Soybean crinkle leaf virus-Japan (AB050781),

PepLCV-Mal– Pepper leaf curl virus-Malaysia (AF414287), ToLCV-

Jv– Tomato leaf curl virus-Java (NC-005031), ToLCV-JvA – Tomato

leaf curl virus-Java[Ageratum] (AB162141), ToLCV-Mal – Tomato

leaf curl virus-Malaysia (NC-004648), and CasMV-SA – South

African cassava mosaic virus (AJ575560) were obtained from

GenBank database at http://www.ncbi.nlm.nih.gov/blast/Blast.cgi

63

Table 5. Percentages of sequence identities of AV1 gene among suspected

Begomoviruses isolates determined in this research and three

Begomoviruses available in the GenBank database.

AYVV PepLCV-Mal CasMV-SA Isolate

identity NT (%) AA (%) NT (%) AA (%) NT (%) AA (%)

ToLC-Bgr 95 97 81 85 78 77

ToLC-Blt 93 95 81 85 89 77

ToLC-Btg 95 96 81 85 87 79

ToLC-Byl 92 93 80 83 86 78

ToLC-Klu 93 90 82 81 84 75

ToLC-Mgl 95 96 81 86 86 80

ToLC-Mlg 94 96 81 86 79 75

ToLC-Srg 94 93 82 81 82 76

Note: AYVV - Ageratum yellow vein virus ( X74516), PepLCV-Mal – Pepper

leaf curl virus - Malaysia (AF414287), and CasMV-SA - South African

cassava mosaic virus (AJ575560) were obtained from GenBank database at

http://www.ncbi.nlm.nih.gov/blast/Blast.cgi

Distance matrices based on AV1 gene amino acid sequences of suspected

Begomovirus isolates determined in this research, AYVV, SCLV-Jpn, PepLCV-

Mal, ToLCV-Jv, ToLCV-JvA, ToLCV-Mal, and SA-CasMV supported previous

finding that the suspected Begomoviruses were indeed isolates of AYVV since

their distances (Table 6) were generally less than 10%. On the other hand, the

distances were generally more than 10% if AV1 gene of the suspected

Begomovirus isolates from Indonesia were compared to that of either PepLCV,

ToLCV-Jv, or ToLCV-JvA, and more than 20% when compared to that of

CasMV-SA. These results indicated that the suspected Begomovirus isolates from

Indonesia were not isolates of PepLCV, ToLCV-Jv, ToLCV-JvA, or CasMV. The

ToLCV-Jv and ToLCV-JvA were the other two Begomovirus isolates from

Indonesia that had previously been reported (Kon et al. 2006).

The AV1 Gene Sequence Diversity

Phylogenetic analysis was carried out based on predicted amino acid

sequences of putative AV1 gene determined in this research and those of other

Begomoviruses available in the GeneBank (Figure 16). The eight Begomovirus

isolates determined in this research were all clustered in similar clade with AYVV

64

from Singapore (AYVV) and Taiwan (AYVV-Tw). However, their sequences

were quite diverse based on the arm length of the phylogenetic tree. Results of this

analysis also indicated that three Begomovirus isolates from Indonesia identified

in previous study (ToLCV-Jv, ToLCV-JvA, and TYLCV-Lbg) did not belong to

the same clade as the isolates identified in this research. The three isolates were

more closely related to PepLCV-Mal than to the eight isolates identified in this

research.

Table 6 Distance matrices (%) based on predicted AV1 gene amino acid

sequences of suspected Begomoviruses isolates determined in this

research, Ageratum yellow vein virus (AYVV), Soybean crinkle leaf

virus (SCLV), Pepper leaf curl virus (PepLCV), Tomato leaf curl virus

(ToLCV), and Cassava mosaic virus (CasMV).

Isolate ToLC-

Blt

ToLC-

Mlg

ToLC-

Srg

ToLC-

Mgl

ToLC-

Byl

ToLC-

Klu

ToLC-

Bgr

ToLC-

Btg

ToLC-Blt

ToLC-Mlg 3,7

ToLC-Srg 7,7 5,0

ToLC-Mgl 3,1 3,1 7,0

ToLC-Byl 6,3 6,3 10,4 4,4

ToLC-Klu 7,7 8,3 10,4 7,7 11,1

ToLC-Bgr 4,4 2,5 5,0 3,1 6,3 8,3

ToLC-Btg 4,4 2,5 3,7 3,7 7,0 9,0 1,8

AYVV 5,0 3,7 6,3 3,1 6,3 9,7 2,5 3,1

SCLV-Jpn 4,4 2,5 6,3 3,1 5,0 9,0 2,5 3,1

PepLCV-Mal 16,2 15,5 18,5 15,5 18,5 20,9 16,2 16,2

ToLCV-Jv 14,0 14,7 15,5 14,0 17,7 15,5 14,7 14,0

ToLCV-JvA 14,7 15,5 17,7 14,7 17,0 17,7 15,5 14,7

ToLCV-Mal 9,0 8,3 12,5 7,7 9,7 14,7 8,3 9,0

CasMV-SA 22,5 23,3 27,6 21,7 23,3 27,6 23,3 24,2

Note: AYVV - Ageratum yellow vein virus (X74516), SCLV-Jpn – Soybean

crinkle leaf virus-Japan (AB050781), PepLCV-Mal– Pepper leaf curl

virus-Malaysia (AF414287), ToLCV-Jv– Tomato leaf curl virus-Java (NC-

005031), ToLCV-JvA–Tomato leaf curl virus-Java[Ageratum]

(AB162141), ToLCV-Mal– Tomato leaf curl virus-Malaysia (NC-004648),

and CasMV-SA– South African cassava mosaic virus (AJ575560) were

obtained from GenBank database at

http://www.ncbi.nlm.nih.gov/blast/Blast.cgi

65

0 0.02 0.04 0.06 0.08 0.10 0.12 0.14 0.16 0.18 0.20

Figure 16 Phylogenetic relationship based on predicted AV1 gene amino acid sequences

of suspected Begomoviruses isolates determined in this research (indicated

with *), and other Begomoviruses available in the GenBank DNA database.

The AV1 gene for AYVV - Ageratum yellow vein virus (X74516), AYVV-Tw

- Ageratum yellow vein Taiwan virus (NC_004627), AYVV-Ch - Ageratum

yellow vein China virus - [G68] (AJ849916), SCLV - Soybean crinkle leaf

virus (AB050781), SLCV-Jpn - Soybean crinkle leaf virus-[Japan]

(AB050781), SLCV-Thai - Soybean crinkle leaf virus-[Thailand]

(EF064788), ToLCV-JvA - Tomato leaf curl Java virus-[Ageratum]

(AB162141), TYLCV-Lbg - Tomato yellow leaf curl Indonesia virus-

[Lembang] (AF189018), ToLCV-Jv - Tomato leaf curl Java virus

(NC_005031), ToLCV-Bang - Tomato leaf curl Bangladesh virus

(AF188481), ToLCV-Lao - Tomato leaf curl Laos virus (AF195782),

ToLCV-Mal - Tomato leaf curl Malaysia virus (NC_004648), ToLCV-Vt

Tomato leaf curl Vietnam virus (NC_004153), ToLCV-Ch - Tomato leaf curl

China virus (ToLCV-Ch), PepLCV-Mal - Pepper leaf curl virus-[Malaysia]

(AF414287), StLCV - Stachytarpheta leaf curl virus (AJ810157), CasMV-SA

- South African cassava mosaic virus (AJ575560), BLCV-Mdgr - Bean leaf

curl Madagascar virus (AM701757), and WmChStV - Watermelon chlorotic

stunt virus (NC_003708) isolates, respectively, were obtained from GenBank

DNA database, available at http://www.ncbi.nlm.nih.gov/blast/Blast.cgi .

* *

* *

* *

* *

66

Discussions

A high incidence of leaf curl disease in tomato plants in Indonesia has

been observed in the last 5 years and it has become a major problem in tomato

growing areas across the country (Hidayat, unpublished data). Association of

begomiviruses with tomato leaf curl disease has been reported mainly from West

Java and Central Java (Sudiono et al. 2001; Aidawati et al. 2005). Detailed

analyses of the molecular properties and biological activities of begomoviruses

from tomato plants with leaf curl in Java has been described recently (Sukamto et

al. 2005; Kon et al. 2006). In this paper, we reported the detection, sequencing,

and phylogenetic analysis of several isolates of tomato begomoviruses collected

from different locations in Java and Sumatra, Indonesia. We conducted analysis

of the genetic diversity based on coat-protein gene sequence after direct

sequencing of PCR products. Direct sequencing of PCR products, after the PCR

parameters were optimimized, has an advantage compared with other strategies,

i.e. it is extremely efficient for the analysis of a large number of sequences in a

short period of time.

Previously it has been known that several begomoviruses are associated

with tomato leaf curl disease in Java, Indonesia. Based on sequence comparisons

and phylogenetic analysis, the viruses were divided into several groups. It is an

interesting facts that all begomoviruses asociated with tomato leaf curl disease in

Java formed separate groups from those of other tomato infecting begomoviruses.

According to Sukamto et al. (2005) and Kon et al. (2006), tomato begomoviruses

from Java had a closest relationship with AYVV. Similarly, Begomovirus isolates

identified in this research showed high sequence identities with that of AYVV,

and also SCLV, and ToLCV-Mal. The AV1 gene predicted amino acid sequences

of the identified isolates exhibited distances of less than 10% against that of the

three Begomoviruses, indicating they were isolates of the same virus species.

Therefore, it was suggested that the identified Begomovirus isolates in this study

might be Indonesian isolates of AYVV or SCLV. Based on AV1 gene sequences

analysis in this study, previous identified tomato begomoviruses from Indonesia,

ToLCV-Jv, ToLCV-JvA, and TYLCV-Lbg, has closed relationship with PepLCV

67

and CasMV. It was not the case for the eight identified Begomovirus isolates in

this study since their predicted amino acid sequence identities and their distances

were either more than 90% and less than 10% (against PepLCV) or more than

80% and less than 20% (against CasMV), respectively.

Although the eight Begomovirus isolates identified in this study exhibited

more than 90 % of the AV1 gene amino acid sequence identities and less than

10% of the distances, results of phylogenetic analysis indicated they belonged into

two different clades. Such results indicated the their AV1 gene might have

originated from the same progenitor sequences but separated different way

because of accumulated mutations. Another possible explanation for such cases

might be because of the occurence of recombination. Differences in accumulated

mutations might not be the answer since the occurence of Begomovirus associated

tomato diseases in Indonesia was only recently. Therefore, recombination might

be the possible cause of such differentiation. More studies would be required

before such possibility be decided. Kitamura et al. (2004) has proposed that

recombination is a very frequent event and widespread phenomenon among

Geminiviruses. Such recombination might occur either at species and genera

levels, respectively. It was also suggested that the genome recombination within

Geminiviruses contributed significantly to the evolution processes of

Geminiviruses.

Based on the analysis above, it is suggested that the existence of

Begomovirus genetic diversity in various regions in Indonesia need further

investigation. Moreover, the prevalence of distinct Begomovirus species or

isolates should also be investigated. Such data will aid the development of control

strategies for viruses and support development of Begomovirus resistance tomato

cultivars through plant breeding.

Conclusion

1. Positive results of the PCR amplification proved that diseased tomato samples

collected from eight locations in Java and Sumatera were infected with at least

one isolate of Begomovirus

68

2. The Blast analysis results using nucleotide and amino acid sequences showed

that the PCR amplified DNA fragment was AV1 gene

3. Identity of nucleic acid and amino acid among AV1 gene among

Begomoviruses indicated that the isolates determined in this research were

Indonesian isolates of AYVV

4. Results of phylogenetic analysis of eight Begomovirus isolates identified in

this study indicated they belonged into two different clades.

Reference

Aidawati N, Hidayat SH, Suseno R, Hidayat P, Sujiprihati S. 2005. Identifikasi

geminivirus yang menginfeksi tomat berdasarkan pada teknik Polymerase

Chain Raction-Restriction Fragment Length Polymorphism. J Mikrobiol

Indones 10:29-32

Altschul SF, Gish W, Miller W, Myers EW, Lipinan DJ. 1990. Basic local

alignment search tool. J of Mol Biol 215: 403-410

AVRDC Centerpoint newsletter-spring 2003 issue

Briddon RW, Robertson I, Markham PG, and Stanley J. 2004. Occurrence of

South African cassava mosaic virus (SACMV) in Zimbabwe. Plant

Pathol. 53(2):233-233

Doyle JJ, Doyle JL. 1990. Isolation of plant DNA from fresh tissue. Focus 12: 13-

15.

Harrison BD. 1985. Advances in geminivirus research. Ann Rev Phytopathol 23:

55-82.

Hidayat SH, Chatchawankanpanich O, Rusli E, Aidawati N. 2006. Begomovirus

associated with pepper yellow leaf curl disease in west Java, Indonesia. J

Indon Microbiol 11 (2): 87-90

Kimura M. 1980. A simple method for estimating evolutionary rate of base

substitution through comparative studies of nucleotide sequences. J Mol

Evol 16: 111-120

Kitamura K, Murayama A, Ikegami M. 2004. Evidence for recombination among

isolates of tobacco leaf curl Japan virus and honeysuckle yellow vein

mosaic virus. Arch Virol 149:1221-1229.

Kon T, Hidayat SH, Hase S, Takahashi H, Ikegami M. 2006. The Natural

occurrence of two distinct begomovirus associated with DNAβ and a

recombinant DNA in a tomato plant. Phytopathol 96: 517-525.

Moriones E, NavasCatillo J. 2000. Tomato yellow leaf curl virus, an emerging

virus complex causing epidemics worldwide. Virus Research 71: 123-134

69

Polkela MA, Svensson E, Rojas A, Horko T, Paulin L, Valkonen JPT,

Kvarnheden A. 2005. Genetic diversity and mixed infections of

begomoviruses infecting tomato, pepper and cucurbit crops in Nicaragua.

Plant Pathol 54: 448-459

Polston JE, Anderson PK. 1997. The emergence of whitefly-transmitted

geminiviruses in tomato in the Western hemisphere. Plant Dis 81:1358-

1369.

Rodriguez PE, Zerbini FM, Ducasse DA. 2006. Genetic diversity of Begomovirus

infecting soybean, bean and associated weeds in Mortwestern Argentina.

Fitopatol Bras 31:342-348

Santoso TJ, Hidayat SH, Herman M, Aswidinnoor H, Sudarsono. 2008. Identitas

dan keragaman genetik Begomovirus yang berasosiasi dengan penyakit

keriting pada tomat berdasarkan teknik Polymerase Chain Reaction

(PCR)-Restriction Fragment Length Polymorphism (RFLP). J Agrobiogen

4(1):- (in press)

Shih SL, Roff MMN, Nakhla MK, Maxwell DP, Green SK. 1998. A new

geminivirus associated with a leaf curl disease of tomato in Malaysia. J of

Zhiwu Baohuxue Hui Huikan 40: 435-435

Sudiono, Hidayat SH, Suseno R, Sosromarsono S. 2001. Molecular detection and

host range study of tomato-infecting begomovirus. In : Proceeding of

Indonesian Phytopathology Soc. Seminar. Bogor. Aug 22-24, 2001. p.

208-217.

Sukamto, Kon T, Hidayat SH, Ito K, Hase S, Takahashi H, Ikegami M. 2005.

Begomovirus associated with leaf curl disease of tomato in Java,

Indonesia. J Phytopathol 153: 562-566.

Tan PH. Wong SM, Wu M, Bedford ID, Saunders K. Stanley J. 1995. Genome

organization of Ageratum yellow vein virus, a monopartite whitefly-

transmitted geminivirus isolated from a common weed. J Gen Virol

76:2915-2922

Thompson JD, Higgins DG, Gibson TJ. 1994. Clustal W: improving the

sensitivity of progressive multiple sequence alignment through sequence

weighting, position-specific gap penalties and weight matrix choice. Nuc

Ac Res 22: 4673-4680

Van Rogenmortel MHV, Fauquet CM, Bishop DHL, Carstens E, Estes MK,

Lemon SM, Maniloff J. Mayo MA, McGeoch DJ, Pringle CR, Wickner

RB. 1999. Virus Taxonomy. Seventh Report of the International

Committee on Taxonomy of Viruses. Academic Press, San Diego.

70

VI. KONSTRUKSI GEN AV1- BEGOMOVIRUS PADA

VEKTOR EKSPRESI DAN INTRODUKSINYA KE TEMBAKAU MENGGUNAKAN VEKTOR A. tumefaciens

Abstrak

Infeksi Begomovirus dilaporkan menyebabkan penyakit keriting tanaman

tomat di beberapa negara, termasuk Indonesia. Penyakit ini telah mengakibatkan

penurunan hasil yang nyata pada produksi tomat. Pada saat ini belum ada cara

yang efektif untuk mengendalikan penyakit yang disebabkan oleh infeksi

Begomovirus tersebut. Penggunaan varietas tomat yang tahan merupakan cara

pengendalian yang terbaik untuk mengkontrol virus tersebut. Teknologi rekayasa

genetik memberikan peluang untuk merakit tanaman transgenik yang tahan

terhadap Begomovirus melalui pendekatan pathogen-derived resistance (PDR).

Gen AV1 dari Begomovirus merupakan gen yang menyandikan protein selubung

yaitu suatu protein yang bertanggung jawab dalam enkapsidasi partikel virus dan

berperan di dalam penentuan spesifisitas penularan virus dan perkembangan

gejala. Tujuan dari penelitian ini adalah untuk mendapatkan konstruksi gen AV1

pada vektor ekspresi dan mengintroduksikan transgen tersebut ke tanaman

tembakau menggunakan vektor bakteri Agrobacterium tumefaciens. Serangkaian

kegiatan untuk konstruksi gen telah dilakukan diantaranya adalah amplifikasi gen

AV1 Begomovirus menggunakan primer spesifik, transformasi ke bakteri E. coli

DH5α dan kloning gen tersebut ke vektor ekspresi pBI121. Eksplan potongan

daun dari tanaman tembakau yang ditumbuhkan secara in vitro ditransformasi

melalui ko-kultivasi dengan A. tumefaciens yang mengandung konstruksi gen

AV1. Hasil penelitian menunjukkan bahwa gen AV1-Begomovirus berhasil

diamplifikasi dan disisipkan ke dalam vektor ekspresi pBI121. Transformasi

genetik telah menghasilkan tanaman-tanaman transforman tembakau yang

membawa gen ketahanan terhadap kanamisin (gen nptII) dan tanaman-tanaman

tersebut telah diaklimatisasi di rumah kaca. Tanaman-tanaman putatif transgenik

tersebut diduga juga telah mengandung gen AV1-Begomovirus. Penelitian lebih

lanjut perlu dilakukan untuk melihat integrasi dan jumlah kopi dari transgen AV1

serta ekspresinya untuk memperoleh ketahanan terhadap infeksi Begomovirus.

Kata kunci: Gen AV1, Begomovirus, Nicotiana tabaccum, Agrobacterium

tumefaciens, protein selubung

71

Abstract

Infection of Begomovirus has caused leaf curl disease in tomato. This

infection has significantly impact on yield losses of tomato production. Recently,

there is no effectively way to control this disease. The use of resistant tomato

variety is the best way to control the virus. Genetic engineering technology gives

the opportunity to develop the transgenic plant resistant to Begomovirus through

pathogen derived resistance (PDR) approach. Begomovirus AV1 gene is a gene

expressing coat protein which responsible for particle encapsidation and have a

role in specivicity determinant of virus transmission and symptom developmment.

The objectives of this study were to construct the Begomovirus AV1 gene in

expression vector plasmid and to introduce the gene into tobacco plant genome

through A. tumefaciens vector. A series activites in gene cloning have conducted

include PCR amplification of AV1 gene using a pair of specific primer, bacterial

transformation of the gene into E. coli DH5α competent cell and cloning the gene

into expression vector plasmid pBI121. Leaf segments of in-vitro tobacco plant

were transformed by co-cultivation with A. tumefaciens containing ToLCV-AV1

construct. In this research, Indonesian Begomovirus AV1 gene was successfully

amplified and inserted in expression vector plasmid. Tobacco transformants

carrying kanamycin-resistant gene (nptII gene) were regenerated and established

in glasshouse. Those transformant plants are expected containing the AV1 gene.

Further experiment need to be conducted to study the integration and copy

number of AV1 transgene as well the expression to obtain the resistance against

virus infection.

Keywords: AV1 gene, Begomovirus, Nicotiana tabaccum, Agrobacterium

tumefaciens, coat protein

72

Pendahuluan

Serangan penyakit keriting daun pada tanaman tomat dan cabai yang

disebabkan oleh infeksi Tomato yellow leaf curl virus (TYLCV), salah satu

anggota Begomovirus telah laporkan di berbagai daerah di Indonesia (Aidawati et

al. 2005, Hidayat et al. 2006). Penurunan hasil akibat serangan penyakit keriting

daun pada tanaman tomat di daerah Bogor, Jawa Barat dan sekitarnya dilaporkan

dapat mencapai 50-70% (Sudiono et al. 2001). Selain itu, serangan penyakit

keriting daun ini dilaporkan dapat menyebabkan penurunan hasil hingga 50-100%

(AVRDC Centerpoint Newsletter – spring 2003 issue) dibandingkan dengan

tanaman tomat yang sehat.

Beberapa pendekatan telah dilakukan untuk mengendalikan Begomovirus

yang menginfeksi tanaman tomat, tetapi hanya sedikit yang terbukti efektif. Usaha

untuk mengendalikan kutu kebul secara biologi juga telah dilakukan, akan tetapi

hasilnya tidak memuaskan (Mason et al. 2000) Sampai saat ini belum ada bahan

kimia yang dapat diaplikasikan secara langsung untuk mengendalikan penyakit

yang disebabkan oleh virus tersebut. Penggunaan varietas tahan merupakan cara

yang tepat untuk mengendalikan virus karena metode ini relatif lebih aman dan

murah apabila dibandingkan dengan metode pengendalian yang lain (Polston &

Anderson 1997; Hanson et al. 2000; Mason et al. 2000).

Usaha untuk memperoleh ketahanan genetik terhadap Begomovirus

terutama untuk TYLCV telah dilakukan. Beberapa peneliti telah mencari gen-gen

ketahanan dan toleransi terhadap TYLCV di antara spesies Lycopersicon liar dan

telah menemukan beberapa gen yang menjanjikan, diantaranya pada spesies L.

chilense Dun, L. pimpinellifolium (Jusl.) Mill, L. hirsutum Dun dan L. peruvianum

(L.) Mill (Zakay et al. 1991; Kasrawi et al. 1998; Pico et al. 1998; Vidavsky &

Czosnek 1998). Akan tetapi, melalui pemuliaan konvensional hanya beberapa

galur dan varietas saja yang telah dihasilkan. Padahal, di daerah sentra produksi

tomat di beberapa negara di dunia, tanaman tomat yang dikembangkan masih

sangat rentan terhadap berbagai Begomovirus (Mason et al. 2000). Selain itu,

kultivar-kultivar yang toleran justru mendukung replikasi virus dan dapat menjadi

sumber inokulum untuk tanaman-tanaman yang rentan (Lapidot et al. 2001).

73

Untuk kasus Indonesia, sumber gen ketahanan untuk mengendalikan Begomovirus

belum ditemukan pada koleksi plasma nutfah tomat. Oleh karena itu, diperlukan

pendekatan lain untuk pengembangan kultivar tomat tahan penyakit keriting yang

disebabkan oleh Begomovirus.

Sebuah konsep ketahanan yang berasal dari patogen (pathogen-derived

resistance, PDR) yang dapat digunakan untuk pengembangan varietas tomat tahan

penyakit keriting (Sanford & Johnson 1985; Dasgupta et al. 2003). Pendekatan

PDR ini memanfaatkan elemen genetik yang dapat berupa gen utuh atau bagian

gen dari genom virus kemudian diklon dan digabungkan dengan sekuen

pengendali (promoter dan terminator) dan diintroduksikan ke tanaman melalui

transformasi genetik tanaman, sehingga akan mempengaruhi satu atau beberapa

tahap penting dalam siklus hidup virus. Pemanfaatan gen selubung protein (coat

protein gene) merupakan salah satu contoh dari pendekatan PDR ini

(Bendahmane et al. 1997; Sinisterra et al. 1999; Vidya et al. 2000; Raj et al.

2005).

Gen AV1 menyandikan protein selubung (coat protein) dan merupakan

gen-gen yang terletak pada utas viral-sense dari Begomovirus monopartite

termasuk Tomato (yellow) leaf curl virus (Horrison BD 1985). Produksi protein

selubung diregulasi oleh gen AC2. Protein selubung mempunyai beberapa fungsi

dan merupakan dasar dari metode serologi untuk deteksi dan identifikasi

Begomovirus. Gen penyandi protein selubung virus (AV1) diisolasi dari virus

untuk memperoleh resistensi non-konvensional terhadap virus dan telah terbukti

efektif untuk mengendalikan geminivirus pada tanaman (Sinisterra et al. 1999;

Raj et al. 2005).

Analisis fungsional ekspresi gen AV1 Begomovirus untuk memperoleh

tanaman tomat tahan terhadap virus dapat dilakukan dengan mengintegrasikan gen

AV1 ke dalam genom dan meregenerasikan tanaman transgenik. Tanaman

tembakau merupakan tanaman model yang dapat digunakan untuk mempelajari

tujuan tersebut karena regenerasi tanaman tembakau sangat mudah dilakukan.

Selain itu, tanaman tembakau juga merupakan salah satu inang dari Begomovirus

sehingga mempermudah untuk pengujian ekspresi gen melalui infeksi virus

(Lazarowitz & Lazdins 1991). Beberapa penelitian untuk mempelajari gen-gen

74

dari virus untuk memperoleh sifat ketahanan telah dilakukan (Pascal et al. 1993;

Sinisterra et al. 1999; Mubin et al. 2007).

Tujuan penelitian ini adalah mendapatkan konstruksi gen AV1

Begomovirus pada plasmid vektor ekspresi dan mengintroduksikan transgen

tersebut ke tanaman tembakau menggunakan vektor bakteri Agrobacterium

tumefaciens.

Bahan dan Metode

A. Konstruksi gen AV1 ke dalam plasmid vektor ekspresi

Amplifikasi gen AV1 dengan primer spesifik

Gen AV1 Begomovirus dari isolat Brastagi dan Kaliurang diamplifikasi

menggunakan teknik PCR mengikuti prosedur yang dikembangkan oleh

Laboratorium Virologi, AVRDC, Taiwan. Amplifikasi gen AV1 dilakukan

menggunakan sepasang primer spesifik gen AV1 (CPPROTEIN-V1 dan

CPPROTEIN-C1). Urutan basa dari primer CPPROTEIN-V1 adalah 5’-

TAATTCTAGATGTCGAAGCGACCCGCCGA-3’ (mengandung situs enzim

XbaI, ditandai dengan garis bawah) dan primer CPPROTEIN-C1 adalah 5’-

GGCCGAATTCTTAATTTTGAACAGAATCA-3’ (mengandung situs enzim

EcoRI). Ukuran produk amplifikasi PCR dari gen AV1 adalah 780 bp. Reaksi

amplifikasi dilakukan dengan total volume 25 ul mengandung 2-5 ul DNA

cetakan, dNTPs dengan konsentrasi 25 µM, primer F dan R masing-masing

dengan konsentrasi 0,2 uM, MgCl2 dengan konsentrasi 1,5 mM, enzim Taq DNA

polymerase 0,15 unit dalam larutan buffer 1X (20mM Tris-HCl pH 8.0, 100mM

KCl, 0,1mM EDTA, 1mM DTT, 50% glycerol, 0,5%, Tween 20, dan 0,5%

nonidet P40). Reaksi amplifikasi dilakukan dengan mesin PCR (MJ Research)

dengan program sebagai berikut: denaturasi pada suhu 940C selama 1 menit,

penempelan primer pada suhu 550C selama 2 menit, dan pemanjangan/sintesis

DNA pada suhu 720C selama 2 menit. Tahapan program PCR tersebut diulang

sebanyak 30 siklus. Pada tahap terakhir proses PCR dilakukan pemanjangan akhir

pada suhu 720C selama 10 menit. Setelah proses PCR selesai, sampel disimpan di

kulkas dengan suhu 40C atau langsung dianalisis dengan gel elektroforesis.

75

Purifikasi dan elusi fragmen DNA hasil PCR

Hasil amplifikasi PCR sebanyak 25 ul di elektroforesis dalam 1% gel

agarosa dengan bufer TBE 0,5X. Dengan pewarnaan pada etidium bromida, pita

DNA diambil dari gel dibawah sinar ultraviolet. Kemudian potongan gel

dipurifikasi menggunakan “S.N.A.P DNA purification kit” (Invitrogen) dan dielusi

menggunakan 40 ul air steril.

Ligasi fragmen DNA pada vektor pGEM-T easy

Sebanyak 3 ul DNA produk PCR yang telah dipurifikasi diligasikan

dengan 1 ul vektor pGEM-T easy (50 ng/ul) dengan bantuan 1 ul enzim T4 DNA

ligase (3 u/ul) dan 5 ul 2x ligation buffer. Selanjutnya campuran diinkubasi pada

suhu 40C selama satu malam.

Transformasi plasmid rekombinan pada bakteri E. coli DH5αααα

Plasmid rekombinan hasil ligasi kemudian ditransformasi ke dalam bakteri

E. coli DH5α dengan metode CaCl2 (heat shock) dari Sambrook et al. (1989).

Sebanyak 200 ul sel kompeten segar (E. Coli DH5α) ditambahkan dengan 10 ul

plasmid hasil ligasi dan diinkubasi di dalam es selama 30 menit, kemudian diberi

kejutan panas pada suhu 420C selama 90 detik dan diinkubasi kembali dalam es

selama 2 menit. Campuran tersebut dijadikan volume akhir 1 ml dengan ditambah

media LB cair (Luria Bertani) sebanyak 800 ul dan digoyang pada suhu 370C

selama 1 jam. Setelah itu, campuran disentrifugasi dan diambil supernatannya

sebanyak 800 ul. Pelet bakteri kemudian dilarutkan kembali pada media cair yang

tersisa (200 ul) dan disebar merata di atas media agar padat yang mengandung

antibiotik ampisilin 50 mg/ml dan diinkubasi pada suhu 370C selama 16 jam.

Koloni bakteri yang terbentuk ditumbuhkan pada 3 ml media LB cair yang

mengandung 50 mg/ml ampisilin dan digoyang pada suhu 370C selama satu

malam.

Isolasi dan verifikasi plasmid dengan enzim restriksi

Isolasi DNA plasmid dari kultur cair bakteri dilakukan dengan metode lisis

alkali (Sambrook et al. 1989). DNA palsmid yang diperoleh kemudian diuji

dengan enzim restriksi untuk konfirmasi keberhasilan penyisipan gen AV1. Untuk

mengidentifikasi fragmen sudah tersisip ke dalam plasmid maka dilakukan

76

verifikasi plasmid dengan memotong plasmid menggunakan enzim restriksi.

Enzim yang digunakan adalah EcoRI. Komposisi reaksi digesti adalah 10x buffer

(2 ul), DNA plasmid (10 ul), enzim EcoRI 1 unit/ul (1 ul) dan air steril (7 ul)

dengan total volume 20 ul. Campuran kemudian diinkubasi pada suhu 370C

selama 2 jam dan hasil pemotongan dielektroforesis pada 1% gel agarosa.

Fragmen sisipan dimurnikan dari gel dan dielusi kembali dengan air steril.

Kloning gen AV1 pada vektor ekspresi

Fragmen gen AV1 diperoleh dari pemotongan klon pGEM-T easy/AV1

dengan enzim XbaI-SacI dan disisipkan ke vektor ekspresi pBI121 yang dipotong

dengan enzim yang sama. Hasil ligasi ditransformasikan ke bakteri E. coli DH5α

dan diseleksi dengan antibiotik kanamisin (100 mg/l). Koloni yang terbentuk

ditumbuhkan kembali pada media LB cair dan diisolasi DNA plasmidnya serta

diverifikasi kembali dengan enzim restriksi yang sesuai. Proses pemotongan dan

ligasi dilakukan sesuai dengan prosedur sebelumnya.

Transformasi DNA rekombinan ke Agrobacterium tumefaciens

DNA rekombinan ditransfromasikan ke bakteri Agrobacterium

tumefaciens strain LBA4404 menggunakan elektroforator (Biorad) dengan

prosedur sesuai dengan petunjuk dari manufaktur. Koloni bakteri yang tumbuh

pada media YEP diisolasi DNA plasmidnya, diverifikasi dengan enzim restriksi

untuk meyakinkan bahwa A. tumefaciens telah membawa plasmid rekombinan

yang benar. Konstruksi plasmid yang benar siap diintroduksikan ke genom

tanaman.

B. Introduksi gen AV1 ke tembakau dengan vektor A. tumefaciens

Persiapan suspensi bakteri A. tumefaciens strain LBA4404

Bakteri Agrobacterium yang membawa konstruksi gen AV1 ditumbuhkan

pada media YEP padat yang mengandung 100 mg/l kanamisin selama 2 hari

sebelum digunakan. Koloni tunggal bakteri diambil dari cawan petri dan

ditumbuhkan pada 5 ml media YEP cair + 100 mg/l kanamisin. Bakteri diinkubasi

pada 280C selama satu malam dengan penggoyangan 200 rpm. Kultur bakteri

diencerkan dengan media MSO cair hingga konsentrasi 0,5 pada OD 600.

77

Persiapan eksplan potongan daun tembakau secara in vitro dan ko-kultivasi

Daun tembakau yang berukuran 2,5–3,5 cm diambil dari perkecambahan

in vitro dan dipotong-potong melintang menjadi 2-3 potongan persegi untuk

digunakan sebagai eksplan. Sebanyak 15-20 eksplan direndam dalam suspensi

bakteri Agrobacterium pada cawan petri yang mengandung 30 mM asetosiringon

selama 30 menit. Eksplan ditanam pada media ko-kultivasi (MS0 dengan vitamin

B5 + 100 mM asetosiringon + 30 g/l sukrosa + 3 g/l phytagel dan pH 5.7) dan

dikulturkan selama 3 hari pada suhu 270C di ruang gelap.

Seleksi dan regenerasi eksplan setelah transformasi

Eksplan dipindahkan ke media seleksi (MS dengan vitamin B5 + 0,1 mg/l

NAA dan 1 mg/l BA + sukrosa 30 g/l + phytagel 3 g/l dan pH 5.7) dengan

penambahan 100 mg/l kanamisin, 50 mg/l cefotaksim dan 500 mg/l karbenisilin.

Komposisi media dasar MS ada pada Lampiran 2. Kultur pada media seleksi

diinkubasi pada ruang kultur dengan suhu 270C dengan fotoperiodisitas cahaya 16

jam terang/8 jam gelap. Eksplan disub-kultur setiap 2 minggu. Eksplan/Kalus

yang bertunas dipindahkan ke media pemanjangan tunas (MS dengan vitamin B5

+ 0,1 mg/l BA + sukrosa 30 g/l + phytagel 3 g/l dan pH 5,7) dengan penambahan

100 mg/l kanamisin, 50 mg/l cefotaksim dan 500 mg/l karbenisilin.

Perakaran tunas transforman

Tunas yang terbentuk pada media pemanjangan tunas dipisahkan dari

kalus dan dipindahkan ke media perakaran (1/2MS + Km100Cb100Ct50 +

sukrosa 30 g/l + phytagel 3 g/l dan pH 5,7) pada botol selai. Planlet yang

terbentuk siap untuk dipindahkan ke pot.

Isolasi DNA genom total tanaman tembakau transgenik putatif.

Isolasi DNA genom total tanaman temabakau transgenik putatif T0

menggunakan metode yang dikembangkan oleh Doyle & Doyle (1990) yang telah

dimodifikasi dengan penambahan 2% polyvinil pyrolidone (PVP). Sebanyak 3 g

daun tanaman dilembutkan dan ditambahkan dengan 700 µl bufer ekstraksi (20

mM EDTA, 100 mM Tris-HCl pH 8.0, 1.4 M NaCl, 2% CTAB, 2% PVP, dan

0.2% Mercaptoetanol) dan diinkubasi selama 15 menit pada penangas air 650C.

Selanjutnya ditambahkan larutan fenol-kloroform-isoamilalkohol (25:24:1) (v/v/v)

78

sebanyak 700 µl. Tabung dibolak-balik secara hati-hati selama 5 menit. Suspensi

disentrifugasi selama 15 menit dengan kecepatan 12000 rpm. Supernatan diambil

dan ditambahkan dengan 1/10x volume 3M Natrium asetat dan 0.7x volume

isopropanol dingin dan dibolak-balik perlahan-lahan. Untuk mengendapkan DNA

dilakukan sentrifugasi selama 10 menit pada kecepatan 12000 rpm. Endapan DNA

dicuci dengan ethanol 70% dan disentrifugasi kembali selama 5 menit pada 12000

rpm. Setelah itu pelet DNA dikeringkan dan dilarutkan kembali dengan bufer TE

1x. Suspensi DNA yang sudah larut siap digunakan untuk cetakan dalam proses

PCR.

Amplifikasi gen nptII pada tanaman transgenik tembakau dengan PCR

Amplifikasi gen nptII pada genom tanaman tembakau transgenik putatif

T0 dilakukan dengan menggunakan primer spesifik. Amplifikasi PCR dilakukan

pada volume total reaksi 25 µl yang mengandung 2-5 ul DNA genomik cetakan,

dNTPs dengan konsentrasi 25 µM, sepasang primer spesifik masing-masing

dengan konsentrasi 0,2 uM, MgCl2 dengan konsentrasi 1,5 mM, enzim Taq DNA

polymerase 0.15 unit dalam larutan bufer 1X. Setiap reaksi dilakukan pada tabung

mikro 200 ul. Reaksi amplifikasi dilakukan dengan program sebagai berikut:

denaturasi awal pada suhu 940C selama 5 menit sebanyak 1 siklus, denaturasi

pada suhu 940C selama 30 detik, penempelan primer pada suhu 55

0C selama 1

menit, dan pemanjangan/sintesis DNA pada suhu 720C selama 2 menit. Tahapan

PCR diulang sebanyak 35 kali. Pada tahap terakhir proses PCR dilakukan

pemanjangan akhir pada suhu 720C selama 5 menit sebanyak 1 siklus. Selain

DNA sampel, juga digunakan DNA plasmid pBI-CP sebagai kontrol positif (+)

dan DNA tanaman tembakau non transgenik serta air (tanpa DNA cetakan)

masing-masing digunakan sebagai kontrol negatif (-). Setelah proses PCR selesai,

sampel produk PCR dielektroforesis dengan gel agarosa.

79

Hasil

A. Konstruksi gen AV1 ke dalam vektor ekspresi

Amplifikasi PCR menggunakan asam nukleat total tanaman dan primer

spesifik gen AV1 Begomovirus dari isolat Kaliurang (CP8) dan Brastagi (CP11)

menghasilkan fragmen DNA berukuran 780 bp (Gambar 17a). Pemilihan isolat ini

berdasarkan dari hasil percobaan sebelumnya dimana kedua isolat tersebut

mewakili dua kelompok yang berbeda dari hasil analisis filogenetik delapan isolat

Begomovirus.

Fragmen gen AV1 hasil amplifikasi diklon ke vektor pGEM-T easy

(Promega) yang merupakan vektor untuk kloning fragmen DNA hasil PCR.

Tujuan pengklonan fragmen gen AV1 ke pGEM-T easy adalah untuk menyimpan

fragmen DNA sehingga mempermudah di dalam perbanyakan fragmen dan

pemilihan ensim restriksi yang sesuai untuk kloning. Setelah ditransformasi ke

bakteri E. coli DH5α, plasmid rekombinan pCP8 dan pCP11 diisolasi dari koloni

tunggal bakteri yang terbentuk. Jumlah koloni tunggal yang terbentuk setelah

transformasi adalah sebanyak 68 koloni untuk CP8 dan 17 koloni untuk CP 11.

Gambar 17 Elektroforesis pada gel agarosa 1%. (a) produk amplifikasi gen AV1

dari dua isolat Begomovirus (CP 8 dan CP11) menggunakan primer

spesifik CPPROTEIN-V1 dan CPPROTEIN-C1. (b) DNA plasmid

rekombinan pCP8 (1-6) dan pCP11 (1-6) hasil isolasi dari koloni

tunggal bakteri E. coli DH5α

Gen AV1

780 bp

1000 bp

850

650

500

CP

8

1 K

b

plu

s

CP

11

4000 bp

3000

2000

1600

1000

650

pC

P8-1

1 K

b

plu

s

pC

P8-2

pC

P8-3

pC

P8-4

pC

P8-5

pC

P8-6

pC

P11-1

pC

P11-2

pC

P11-3

pC

P1

1-4

pC

P1

1-5

pC

P1

1-6

pG

EM

-T e

asy

a b

80

Sebanyak 12 koloni bakteri yang terdiri dari 6 koloni pCP8 (pCP8-1,

pCP8-2, pCP8-3, pCP8-4, pCP8-5, dan pCP8-6) dan 6 koloni pCP11 (pCP11-1,

pCP11-2, pCP11-3, pCP11-4, pCP11-5, dan pCP11-6) dipilih untuk

memverifikasi plasmid rekombinan yang membawa gen AV1. Ternyata dari 12

koloni bakteri tersebut hanya 1 koloni yang tidak membawa plasmid rekombinan,

yaitu koloni pCP8-6 (Gambar 17b).

Untuk mendapatkan fragmen gen AV1 dan vektor ekspresi pBI121

mempunyai ujung yang kohesif sebelum diligasikan maka gen AV1 yang telah

diklon pada pGEM-T dipotong dengan 2 enzim restriksi XbaI dan SacI. Demikian

juga dengan vektor ekspresi pBI121. Enzim restriksi XbaI dan SacI hanya akan

memotong pada bagian gen GUS pada vektor plasmid pBI121 namun elemen

promoter 35S CaMV dan terminator NOS masih ada (Gambar 18). Bagian gen

GUS yang dipotong inilah nanti yang akan digantikan oleh gen AV1.

Pemotongan plasmid pCP8 dan pCP11 dengan enzim XbaI dan SacI dapat

menggambarkan orientasi dari sisipan gen AV1 pada pGEM-T easy (Gambar 19).

Dari 7 plasmid rekombinan yang dipotong dengan enzim restriksi terdapat lima

plasmid yang membawa gen AV1 dengan orientasi yang diinginkan yaitu pCP8-1,

pCP8-3, pCP8-4, pCP11-8, dan pCP11-11. Dua plasmid yang lain (pCP8-2 dan

pCP11-7) membawa gen AV1 dengan orientasi yang terbalik sehingga ketika

dipotong dengan enzim XbaI dan SacI tidak menghasilkan fragmen gen AV1.

Gambar 18 Peta plasmid biner pBI121 yang membawa gen pelapor gus dan gen

marker nptII pada struktur T-DNAnya

GUS

pBI 121 13950 bp

81

Gambar 19 Elektroforesis fragmen gen AV1 yang dipotong dari vektor pGEM-T

easy dan fragmen gen GUS dari vektor ekspresi pBI121 dengan

enzim restriksi XbaI dan SacI pada gel agarosa 1%. AV1 = fragmen

gen AV1 yang berukuran 780 bp; GUS = fragmen gen GUS yang

berukuran 2000 bp.

Selanjutnya hasil ligasi antara fragmen sisipan (gen AV1 atau gen GUS)

dan vektor pBI121 ditransformasi ke bakteri E. coli DH5α. Jumlah koloni yang

terbentuk pada transformasi plasmid rekombinan hasil ligasi antara gen AV1 dan

vektor ekspresi pBI121 adalah sebanyak 12 koloni untuk pBI121/AV1-CP8 dan

16 koloni untuk pBI121/AV1-CP11. Setelah diperoleh DNA plasmid dari koloni

tunggal bekteri hasil transformasi, dilakukan verifikasi untuk memilih plasmid

rekombinan yaitu memiliki gen AV1 sebagai sisipannya.

Dari delapan koloni tunggal yang mengandung plasmid rekombinan

diperoleh empat plasmid rekombinan yang mengandung sisipan gen AV1, masing-

masing 2 plasmid rekombinan dari CP8 (pCP8-1-2 dan pCP8-1-3) dan 2 plasmid

dari CP11 (pCP11-8-1 dan pCP11-8-2) (Gambar 20). Dari plasmid rekombinan

tersebut dapat dibuat peta plasmid yang baru (Gambar 21). Plasmid rekombinan

tersebut telah berhasil ditransformasi ke bakteri A. tumefacies dan menghasilkan

koloni tunggal bakteri yang siap digunakan untuk transformasi genetik tanaman

tembakau.

pB

I12

1

12000 bp

3000

2000

1600

1000

500

100

GUS

AV1 AV1 AV1 AV1 AV1

pC

P8

-1

pC

P8

-2

pC

P8

-3

pC

P8

-4

pC

P1

1-7

pC

P1

1-8

pC

P1

1-1

1

1 K

b p

lus

82

Gambar 20 Elektroforesis hasil verifikasi insersi fragmen gen AV1 dengan enzim

restriksi XbaI dan SacI. Fragmen gen GUS ditandai dengan pita DNA

berukuran 2000 bp dan fragmen gen AV1 ditandai dengan pita DNA

berukuran 780 bp.

Gambar 21 Peta konstruksi plasmid biner pBI-CP yang membawa gen AV1

Begomovirus dengan promoter 35S-CaMV dan terminator nos, dan

gen marker nptII pada struktur T-DNA

12000 bp

3000

2000 1600

1000

500

100

Gen GUS

2000 bp

Gen AV1

780 bp

pB

I121

pC

P8-1

-1

pC

P8-1

-2

pC

P8-1

-3

pC

P8-1

-4

pC

P11-8

-1

pC

P11-8

-2

pC

P11-8

-4

1 K

b p

lus

pC

P11-8

-3

83

B. Introduksi gen AV1 ke tembakau dengan vektor A. tumefaciens

Introduksi gen AV1-Begomovirus ke tanaman tembakau melalui tahapan

transformasi genetik dengan bantuan vektor A. tumefaciens (Gambar 22)

dilakukan 4 kali (dua kali untuk masing-masing konstruksi gen CP8/AV1 dan

CP11/AV1). Transformasi dilakukan dengan jumlah total eksplan sebanyak 273

potongan daun. Dari empat kali transformasi dihasilkan sebanyak 1593 tunas yang

tahan pada media seleksi yang mengandung antibiotik kanamisin 100 mg/l dengan

rerata tunas per eksplan adalah sebesar 5,84. Setelah dipindahkan ke media

perakaran dan diaklimatisasi diperoleh sebanyak 1399 planlet yang tahan

kanamisin dengan rerata planlet per eksplan adalah 5,12 (Tabel 7). Dari data yang

diperoleh, rerata persentase keberhasilan tunas menjadi planlet adalah sebesar

88,52%.

Tabel 7 Jumlah tunas dan planlet yang dihasilkan serta persentase tunas menjadi

planlet pada transformasi genetik tembakau dengan gen AV1

Begomovirus melalui vektor A. tumefaciens

Konstruksi

gen

Transf.

ke -

Jumlah

eksplan

Jumlah

tunas*

Jumlah

planlet**

%-ase tunas

menjadi

planlet***

1 62 332 (5,44) 298 (4,88) 89,76 CP8/AV1

2 62 323 (5,38) 290 (4,83) 89,78

1 90 627 (7,29) 532 (6,18) 84,85 CP-11/AV1

2 59 311 (5,36) 279 (4,81) 89,71

Total 273 1593 1399 -

Rerata 68,25 398, 25(5,84) 349,75 (5,12) 88,52

* Angka dalam kurung menunjukkan jumlah tunas/eksplan

** Angka dalam kurung menunjukkan jumlah planlet/eksplan

*** Persentase tunas menjadi planlet dihitung berdasarkan jumlah planlet yang

terbentuk dibagi dengan jumlah tunas yang terbentuk dikalikan dengan 100%

84

Gambar 22 Transformasi genetik tembakau dengan gen AV1 melalui vektor A.

tumefaciens. (a) Tanaman tembakau in vitro sebagai sumber eksplan,

(b) Eksplan potongan daun pada media induksi kalus yang

mengandung kanamisin 100 mg/l setelah ko-kultivasi dengan bakteri

A. tumefaciens, (c) Eksplan mulai memperlihatkan adanya

pertumbuhan tunas, (d) Eksplan dengan tunas-tunas yang muncul di

tempat pelukaan, (e) Eksplan tidak ditransformasi yang ditumbuhkan

pada media seleksi kanamisin 100 mg/l, (f) Tunas-tunas hasil

transformasi pada media perakaran, (g) Tunas-tunas yang sudah

berakar pada media perakaran di tabung reaksi, (h) Tunas-tunas yang

sudah berakar pada media perakaran di botol, (i) Planlet yang sudah

diaklimatisasi pada media tanah pada bak plastik

a b c

d e f

g h i

85

Analisis PCR untuk deteksi gen ketahanan terhadap kanamisin nptII

Amplifikasi gen nptII dengan PCR pada 46 tanaman tembakau transgenik

putatif generasi T0 menggunakan primer spesifik menghasilkan 35 tanaman yang

mengandung gen nptII (Gambar 23). Hal ini diindikasikan dengan terbentuknya

pita DNA berukuran sekitar 250 bp. Persentase tanaman yang mengandung gen

nptII dibandingkan dengan jumlah total tanaman yang dianalisis adalah sebesar

76,1%. Pada kontrol negatif yang digunakan (tanaman tembakau yang tidak

ditransformasi dan air) tidak menunjukkan adanya pita hasil amplifikasi (250 bp)

(Gambar 23). Hal tersebut menunjukkan bahwa prosedur teknik PCR yang

digunakan untuk amplifikasi gen nptII sudah benar dan tidak terdapat kontaminasi

oleh DNA dari sampel yang diuji atau DNA dari sumber yang lain.

Gambar 23 Elektroforesis gel hasil amplifikasi gen nptII pada 46 tanaman

tembakau transgenik putatif generasi T0 menggunakan primer PCR

spesifik. Kolom no 1-46 = sampel tanaman, K− = tembakau non

transforman, A = Air, + = Plasmid, M = 1 Kb plus ladder (In

vitrogen)

21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 K- M A + 41 42 43 44 45 46

nptII

500 bp

100

300

17 18 19 20 K- M A +

nptII 500 bp

100

300

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16

86

Pembahasan

Salah satu komponen penting di dalam mempelajari ekspresi suatu gen

adalah kegiatan kloning dan konstruksi dari gen yang akan diekspresikan tersebut.

Pada penelitian ini, gen yang akan dikloning dan dikonstruksi adalah gen AV1

yaitu gen yang mengekspresikan protein selubung. Protein selubung adalah suatu

protein yang berperan di dalam penentuan spesifisitas penularan virus (Briddon et

al. 1990) dan perkembangan gejala (Gardiner et al. 1988). Berdasarkan kenyataan

ini, maka melalui strategi pendekatan pathogen derived resistance (PDR) gen AV1

dapat digunakan untuk mentransformasi tanaman inang sehingga memberikan

proteksi terhadap infeksi Begomovirus.

Pada penelitian ini, gen AV1 dari dua isolat begomovirus yaitu isolat

Kaliurang (diberi kode CP-8) dan isolat Brastagi (diberi kode CP-11) telah

berhasil diamplifikasi menggunakan primer spesifik yang didesain untuk

mengamplifikasi gen tersebut. Keberhasilan ini ditandai dengan diperolehnya

amplikon yang berukuran sekitar 780 pasangan basa (Gambar 25). Untuk

memfasilitasi pemilihan enzim restriksi yang akan digunakan untuk kloning gen

AV1 pada vektor ekspresi maka amplikon gen AV1 tersebut dikloning ke dalam

suatu vektor kloning pGEM-T easy (Promega). Vektor kloning ini mempunyai

beberapa keuntungan, diantaranya adalah 1) dapat digunakan untuk mengkloning

fragmen hasil PCR yang menggunakan enzim DNA polymerase tertentu yang

akan menghasilkan fragmen dengan ujungnya mempunyai ekor basa A dimana

vektor pGEM-T mempunyai ujung T, 2) vektor ini juga mempunyai polycloning

site yang akan mempermudah di dalam pemilihan enzim restriksi untuk kloning.

3) Vektor ini juga merupakan plasmid yang memiliki kemampuan propagasi

tinggi sehingga sangat membantu di dalam perbanyakannya pada sel kompeten

seperti E. coli.

Untuk melihat ekspresinya, gen AV1 disisipkan pada vektor ekspresi

pBI121 (Clontech Labs Inc., Palo Alto, CA) yang merupakan vektor ekspresi

konstitutif untuk tanaman yang mengandung gen neomycinphospho-transferase II

(nptII) untuk seleksi dan gen pelapor β-glucuronidase (gus). Konstruksi gen

dilakukan dengan memotong dan mengganti gen pelapor gus yang berukuran

87

2000 bp dengan gen AV1 yang berukuran sekitar 780 bp. Proses ligasi standar atau

klasik dilakukan dengan cara menggabungkan satu fragmen DNA sisipan linier ke

satu DNA vektor (Sambrook et al. 1989). Pada penelitian ini, pendekatan ligasi

yang dilakukan adalah dengan ”competition approach” dimana ada dua gen

sisipan yang digabungkan dengan satu DNA vektor. Dalam hal ini, gen AV1 dan

gen gus akan berkompetisi untuk berligasi pada vektor ekspresi pBI121. Ini

dilakukan dengan cara meligasikan vektor ekspresi pBI121 (yang sebelumnya

telah dipotong dengan enzim XbaI dan SacI) dengan fragmen gen AV1. Skrining

plasmid rekombinan dilakukan dengan memotong kembali plasmid dengan enzim

XbaI dan SacI. Plasmid rekombinan yang diinginkan akan mudah teridentifikasi

karena fragmen gen AV1 (780 bp) dan gus (2000 bp) mempunyai ukuran yang

berbeda (Gambar 20).

Untuk mempelajari ekspresi gen AV1 dari Begomovirus yang

menyandikan protein selubung di dalam hubungannya dengan ketahanan terhadap

penyakit keriting daun maka gen AV1 diintroduksikan ke dalam genom tanaman

tembakau. Integrasi gen AV1 ke dalam tanaman model ini diharapkan akan

memberikan informasi mengenai keefektifan gen tersebut untuk mengendalikan

penyakit keriting daun yang disebabkan oleh infeksi Begomovirus tersebut.

Tanaman model tembakau selama ini telah terbukti efektif untuk kegiatan

rekayasa genetika karena tanaman tersebut mempunyai kompetensi regenerasi dan

transformasi yang tinggi. Selain itu, tanaman tembakau juga merupakan salah satu

tanaman inang yang dapat diinfeksi oleh Begomovirus sehingga akan

memudahkan di dalam pengujian ketahanan terhadap virus. Beberapa penelitian

yang mempelajari ekspresi gen untuk ketahanan terhadap virus melalui

transformasi genetik menggunakan tanaman tembakau telah dilaporkan (Pascal et

al. 1993; Sinisterra et al. 1999; Mubin et al. 2007).

Hasil penelitian ini menunjukkan bahwa tanaman tembakau mempunyai

kompetensi transformasi dan regenerasi yang tinggi. Kompetensi transformasi

diindikasikan oleh tingginya jumlah tunas yang dihasilkan pada media seleksi

yang mengandung antibiotik kanamisin 100 mg/l dengan rerata jumlah tunas per

eksplan adalah 5,84 (Tabel 7). Kompetensi regenerasi tanaman tembakau yang

tinggi diindikasikan oleh kemampuan eksplan beregenerasi membentuk tunas dan

88

akhirnya tumbuh menjadi planlet dengan persentase tunas menjadi planlet adalah

88,52% (Tabel 7). Perlakuan transformasi dengan bakteri A. tumefaciens dan

tekanan seleksi dari antibiotik kanamisin (100 mg/l) pada media regenerasi tidak

mempengaruhi kemampuan eksplan untuk membentuk tunas.

Salah satu parameter keberhasilan dari teknik transformasi adalah

tersisipnya gen yang diinginkan ke dalam genom tanaman. Untuk mendeteksi

keberadaan gen pada tanaman transgenik putatif dapat dilakukan dengan analisis

molekuler, salah satunya menggunakan teknik PCR. Meskipun teknik ini belum

menjamin bahwa transgen telah terintegrasi ke dalam genom tanaman namun

teknik ini dapat digunakan untuk skrining awal secara cepat tanaman transgenik

putatif. Pada penelitian ini, telah berhasil dideteksi tanaman tembakau transgenik

putatif yang membawa gen ketahanan terhadap kanamisin dengan teknik PCR

menggunakan primer spesifik gen nptII. Gen nptII ini berada satu konstruksi

dengan gen AV1 pada T-DNA, sehingga diharapkan tanaman yang terdeteksi

membawa gen nptII juga membawa gen AV1.

Tanaman yang diperoleh dari hasil transformasi genetik menggunakan gen

AV1 selanjutnya perlu untuk dikonfirmasi keberadaan, integrasi dan jumlah kopi

dari transgen yang diintroduksikan menngunakan teknik molekuler seperti teknik

PCR dan Southern Blot, meskipun planlet-planlet merupakan planlet-planlet yang

putatif transgenik karena telah lolos pada media seleksi. Selain itu, ekspresi dari

gen yang sudah terintegrasi pelu diuji dengan menggunakan virus target sehingga

akan diketahui tingkat efektifitas dari gen yang telah disisipkan.

Simpulan

1. Gen AV1 dari isolat Begomovirus yang berukuran sekitar 780 telah dapat

diamplifikasi dan dikonstruksi pada vektor ekspresi untuk digunakan dalam

transformasi genetik.

2. Transfomasi genetik tanaman tembakau dengan gen AV1 menggunakan vektor

bakteri A. tumefaciens telah menghasilkan transforman-transforman yang

membawa gen ketahanan terhadap kanamisin (gen nptII).

89

Daftar Pustaka

Aidawati N, Hidayat SH, Suseno R, Hidayat P, Sujiprihati S. 2005. Identifikasi

geminivirus yang menginfeksi tomat berdasarkan pada teknik Polymerase

Chain Raction-Restriction Fragment Length Polymorphism. J Mikrobiol

Indones 10:29-32

AVRDC Centerpoint newsletter-spring 2003 issue

Bendahmane M, Fitchen JH, Zhang G, Beachy RN. 1997. Studies of coat protein-

Mediated Resistance to tobacco mosaic Tobamovirus: Correlation between

assembly of mutant coat proteins and resistance. J Virol 71(10): 7942-

7950

Briddon RW, Pinner MS, Stanley J, Markham PG. 1990. Geminivirus coat protein

gene replacement alters insect specificity. Virol 177:85-94

Dasgupta I, Malathi VG, Mukherjee. 2003. Genetic engineering for virus

resistance. Current Scim 8(3): 341-354

Gardiner WE, Sunter G, Brand L, Elmer JS, Rogers SG, Bisaro DM. 1988.

Genetic analysis of tomato golden mosaic virus: The coat protein is not

required for systemic spread or symptom development. Eur Mol Biol

Organ J 7:899-904

Hanson P, Bernacchi, DM, Green S, Tanksley SD, Muniyappa V, Padmaja AS,

Chen HM, Kuo G, Fang D, Chen JT. 2000. Mapping a Wild Tomato

Introgression Associated with Tomato Yellow Leaf Curl Virus Resistance

in Cultivated Tomato Line. J. Amer. Soc. Hort. Sci. 125(1):15-20

Harrison BD. 1985. Advances in geminivirus research. Ann Rev Phytopathol 23:

55-82.

Hidayat SH, Chatchawankanpanich O, Rusli E, Aidawati N. 2006. Begomovirus

associated with pepper yellow leaf curl disease in west Java, Indonesia. J

Indon Microbiol 11 (2): 87-90

Kasrawi MA, Suwwan MA, Mansour. 1988. Sources of resistance to tomato

yellow leaf curl virus in Lycopersicon species. Euphytica 37:61-64

Lapidot M, Friedmann M, Pilowsky M, Ben-Joseph, Cohen S. 2001. Effect of

host plant resistance to Tomato yellow leaf curl virus (TYLCV) on virus

acquisition and transmission by its whitefly vector. Phytopathol 91:1209-

1213

Lazarowitz SG, Lazdins IB. 1991. Infectivity and complete nucleotide sequence

of the cloned genomic components of a bipartite squash leaf curl

geminivirus with a broad host range phenotype. Virol 180(1):58–69.

Mason G, Rancati M, Bosco D. 2000. The effect of thiamethoxam, a second

generation neonicotinoid insecticide, in preventing transmission of tomato

yellow leaf curl geminivirus (TYLCV) by the whitefly Bemisia tabaci

(Gennadius). Crop protection 19:473-479

90

Mubin M, Mansoor S, Hussain M, Zafar Y. 2007. Silencing of the AV1 gene by

antisense RNA protects transgenic plants against a bipartite begomovirus.

Virol J 4(10):1-4

Pascal E, Goodlove PE, Wu LC, Lazarowitz. 1993. Transgenic tobacco plants

expressing the Geminivirus BL1 protein exhibit symptoms of viral disease.

Plant Cell 5: 795-807

Pico B, Diez MJ, Nuez F. 1998. Evaluation of whitefly-mediated inoculation

techniques to screen Lycopersicon esculentum and wild relatives for

resistance to Tomato yellow leaf curl virus. Euphytica 101:259-271

Polston JE, Anderson PK. 1997. The emergence of whitefly-transmitted

geminiviruses in tomato in the Western hemisphere. Plant Dis 81:1358-

1369

Raj SK, Singh R, Pandey SK and Singh BP. 2005. Agrobacterium-mediated

tomato transformation and regeneration of transgenic lines expressing

Tomato leaf curl virus coat protein gene for resistance against TLCV

infection. Current Sci 88 (10): 1674-1679

Sanford JC, Johnson SA. 1985. The concept of parasite-derived resistance:

deriving resistance genes from the parasites own genome. J Theor Biol

115:395-405

Sambrook J. Fritsc EF, Maniatis T. 1989. Molecular cloning, a laboratory

manual2nd

edition. Cold Spring Harbor Laboratory Press. Book 1, 2 dan 3

Sinisterra XH, Polston JE, Abourized AM, Hiebert E. 1999. Tobacco plants

transformed with a modified coat protein of tomato mottle Begomovirus

show resistance to virus infection. Phytopathol 89:701-706

Sudiono, Hidayat SH, Suseno R, Sosromarsono S. 2001. Molecular detection and

host range study of tomato-infecting begomovirus. In : Proceeding of

Indonesian Phytopathology Soc. Seminar. Bogor. Aug 22-24, 2001. p.

208-217.

Vidavsky F, Czosnek H. 1998. Tomato breeding lines resistant and tolerant to

tomato yellow leaf curl virus issued from Lycopersicon hirsitum.

Phytopathol. 88:910-914

Vidya CSS, Manoharan M, Kumar CTR, Savithri HS, Sita GL. 2000.

Agrobacterium-mediated transformation of tomato (Lycopersicon

esculentum var. Pusa Ruby) with coat protein gene of Physalis mottle

tymovirus. J Plant Physiol 156: 106-110

Zakay Y, Navot N, Zeidan M, Kedar N, Rabinowitch H, Czosnek H, Zamir D.

Screening Lycopersicon accessions for resistance to tomato yellow leaf

curl virus: presence of viral DNA and symptom development. Plant Dis

75:279-281