biquitination of bor1 for vacuolar sorting · 12/9/2010 · bor2-1, (bor2 forward)...
TRANSCRIPT
1
High boron-induced ubiquitination regulates vacuolar sorting of the BOR1 borate transporter
in Arabidopsis thaliana
Koji Kasai‡, Junpei Takano§, Kyoko Miwa‡,1, Atsushi Toyoda‡,2, Toru Fujiwara‡, ¶, !,3
From the ‡Biotechnology Research Center, The University of Tokyo, Tokyo 113-8657, Japan,
the §Research Faculty of Agriculture, Hokkaido University, Sapporo, 060-8589, Japan,
the ¶Graduate School of Agricultural and Life Sciences, The University of Tokyo, Tokyo 113-8657,
Japan.
the Core Research for Evolutional Science and Technology (CREST), Japan Science and Technology
Agency, Saitama 332-0012, Japan.
Running Head: Ubiquitination of BOR1 for vacuolar sorting 1Present address: Creative Research Institution, Hokkaido University Kita-ku, Sapporo, 001-0021,
Japan 2Present address: Food Technology Department, Nagano Prefecture General Industrial Technology
Center, 205-1 Aza-Nishibanba, Oaza-Kurita, Nagano-shi, Nagano 380-0921 Japan. 3Address correspondence to: Toru Fujiwara, Department of Applied Biological Chemistry, Graduate
School of Agricultural and Life Sciences, University of Tokyo, Tokyo 113-8657 1-1-1 Yayoi,
Bunkyo-ku, Tokyo 113-8657, Japan. Tel.: 81-3-5841-5104; Fax: 81-3-5841-8032; E-mail:
Boron (B) homeostasis is important for plants,
as B is essential but is toxic in excess. Under
high-B conditions, the Arabidopsis thaliana
borate transporter BOR1 is trafficked from
the plasma membrane (PM) to the vacuole via
the endocytic pathway for degradation to
avoid excess B transport. Here, we show that
B-induced ubiquitination is required for
vacuolar sorting of BOR1. We found that a
substitution of lysine 590 with alanine
(K590A) in BOR1 blocked degradation.
BOR1 was mono- or diubiquitinated within
several minutes after applying a high
concentration of B, whereas the K590A
mutant was not. The K590A mutation
abolished vacuolar transport of BOR1 but
did not apparently affect polar localization to
the inner PM domains. Furthermore,
brefeldin-A and wortmannin treatment
suggested that K590 is required for BOR1
translocation from an early endosomal
compartment to multivesicular bodies
(MVBs). Our results show that the B-induced
ubiquitination of BOR1 is not required for
endocytosis from the PM but is crucial for
sorting of internalized BOR1 to MVBs for
subsequent degradation in vacuoles.
Although boron (B) is an essential
micronutrient for plants, excess B is toxic. The
homeostasis of B is important for plants. In fact,
http://www.jbc.org/cgi/doi/10.1074/jbc.M110.184929The latest version is at JBC Papers in Press. Published on December 9, 2010 as Manuscript M110.184929
Copyright 2010 by The American Society for Biochemistry and Molecular Biology, Inc.
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
2
both B deficiency and toxicity have negative
impacts on agricultural production (1, 2). The
only established function of B in vascular plants
is cross-linking of the pectic polysaccharide
rhamnogalacturonan II (RG-II). This
cross-linking mediated by borate is important to
maintain cell-wall architecture and is necessary
for normal growth and development (3, 4). In
contrast, the molecular mechanism of B toxicity
is still unclear despite several efforts applying
biochemical, genetic, and molecular approaches
(5-9).
B is taken up by plant roots mainly in the
form of boric acid. Arabidopsis thaliana
possesses two distinct types of B-transporting
proteins, BOR1 (10) and NIP5;1 (11), for
effective B uptake into roots and transport to
shoots under B-limiting conditions (12). BOR1
is an efflux-type borate transporter with
similarities to animal bicarbonate transporters
(13). In roots, BOR1 is polar localized to the
inner (stele-facing) plasma membrane (PM)
domain of various cells (14) and functions in
inward transport of B toward the stele under
low-B conditions (10). NIP5;1 is a member of
the major intrinsic protein (MIP) family and
functions as a boric acid channel for efficient B
uptake into the root under B-limiting conditions
(11). NIP5;1 is polar localized to the outer
(soil-facing) PM domain of root epidermal and
root cap cells (14) and increases the permeability
of the outermost PM domain to boric acid for
efficient B uptake.
These transporters have been successfully
used to generate B-stress-tolerant plants. BOR1
overexpression in A. thaliana results in
enhanced B translocation from the root to shoot
and improved shoot growth and seed yields
under B-limiting conditions (15). Enhancing
NIP5;1 expression by activation tag improves
root growth under B-limiting conditions (16).
Overexpression of BOR4, a BOR1 paralog,
reduces B concentration in both roots and shoots
and confers tolerance to toxic levels of B (17).
Accumulations of NIP5;1 and BOR1 are
regulated by B availability via different
regulatory mechanisms. NIP5;1 is regulated at
the level of mRNA accumulation in response to
B concentration in the media (11), whereas
BOR1 accumulation is regulated through protein
degradation. In the presence of high B
concentrations, BOR1 is rapidly removed from
the PM and transferred to the lytic vacuole
through the endocytic pathway for prompt
degradation (18). The endocytic degradation
system is assumed to be beneficial for plants to
quickly shut down B transport and avoid excess
accumulation of B.
Endocytic membrane trafficking is a key
mechanism to control protein amount in the PM.
During endocytic degradation, the target protein
is internalized from the PM to the early
endosomal compartments by endocytosis, sorted
into late endosomes (LEs)/multivesicular bodies
(MVBs), and transferred into
vacuoles/lysosomes for degradation (19).
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
3
Although the details of this mechanism have
been intensively studied in yeast and mammals
(19-22), much less knowledge has accumulated
in plants. A recent report demonstrated that the
A. thaliana brassinosteroid insensitive1 (BRI1)
receptor and BOR1 are sorted into LEs/MVBs
for vacuolar degradation through the
trans-Golgi/early endosome (TGN/EE) network
(23). Ubiquitination is a key signal for the
homeostatic regulation of proteins. Two distinct
forms of ubiquitination are known:
polyubiquitination is used in the proteosomal
protein degradation system, and mono- and
multi-monoubiquination are required for
endocytic internalization of transmembrane
proteins for lysosomal/vacuolar turnover of
membrane proteins in yeast and mammals (19).
In addition, monoubiquitination has also been
reported as a sorting signal of the membrane
proteins to MVBs in mammals (24). This
ubiquitination is required for binding to the
endosomal protein sorting complex (ESCRT). In
A thaliana, the ESCRT-related proteins
CHMP1A and CHMP1B are required for MVB
sorting of the three auxin carriers PIN1, PIN2,
and AUX1 (25). PIN2 turnover, which is related
to root gravitropism, is regulated by endocytic
membrane trafficking and proteasome activity
(26). This study showed that PIN2 is modified
by ubiquitin, and that ubiquitination depends on
proteasome activity; however, whether
polyubiquitination or multi-monoubiquitination
is required remains unclear. In addition, no
direct evidence exists that ubiquitination is
involved in PIN2 degradation (26).
Here, we identified an ubiquitination site
in BOR1, which is required for B-induced
vacuolar sorting of BOR1. We previously
reported that BOR4, unlike BOR1, is not
degraded by high-B (+B) supplementation (17).
Thus, in this study, we searched amino acid
residues involved in B-induced degradation of
BOR1 by differences between the BOR1 and
BOR4 sequences, and found that lysine 590
(K590) was critical for the degradation.
Supplementation with high-B induced mono- or
diubiquitination of GFP-tagged BOR1
(BOR1-GFP), and a K590 mutation completely
inhibited ubiquitination. Furthermore, the K590
mutation did not inhibit the endocytosis step
from the PM but prevented MVB sorting of
BOR1 for degradation in the vacuole.
MATERIALS AND METHODS
Plasmid construction and plant
transformation–Binary plasmids for plant
transformation to express GFP-fused BOR
mutants under control of the BOR1 promoter
were generated using Gateway technology
(Invitrogen, Carlsbad, CA, USA). Construction
of BOR1–BOR4 chimeras and site-directed
mutagenesis were conducted using the in vitro
overlap–extension PCR method (27).
BOR1-GFP (10) or BOR4-GFP (17) constructs
were used as templates, and the primers used are
listed in Supplemental Table I. The PCR
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
4
fragments of GFP-tagged genes were subcloned
into pENTR/D-TOPO (Invitrogen) according to
the manufacturer’s instructions and sequenced to
confirm that that no PCR error occurred. The
subcloned GFP-tagged genes were mobilized
into pAT100 (14), a destination binary vector
carrying the BOR1 promoter, with LR clonase
(Invitrogen), according to the manufacturer’s
instructions.
The resulting binary plasmids were
introduced into Agrobacterium tumefaciens
strain GV3101:pMP90 (28). A. thaliana
bor1-3/2-1 plants, a BOR1/BOR2 double null
mutant, were transformed using the floral dip
method (29).
To generate a T-DNA insertion mutant for
both BOR1 and BOR2, T2 seeds of bor1-3
(SALK_37312) and bor2-1 (SALK_56473)
were obtained from the Salk Institute (30)
(http://signal.salk.edu/cgi-bin/tdnaexpress).
bor1-3 and bor2-1 are in the Col-0 background
and carry T-DNAs in their exons. The plants
were crossed and those homozygous for both
T-DNAs were selected by PCR. The primers
used for PCR were for bor1-3, (BOR1 forward)
5'-GCATACCAAGAGCTTAGCAACT-3',
(BOR1 reverse)
5'-TGGAGTCGAACTTGAACTTGTC-3' and
the SALK left border (LBb1),
5'-GATGGCCCACTACGTGAACCAT-3', for
bor2-1, (BOR2 forward)
5'-CATGCAACAAGCCATCAAAG-3', (BOR2
reverse) 5'-AAATCCAAGAAGAAGCAGAT-3'
and the SALK left border (LBb1).
Plant growth conditions–MGRL medium (31)
was prepared with slight modifications
according to Takano et al (18) and used with
various concentration of boric acid as the B
source. MGRL solid medium was made with
1.5% gellangum (Wako Pure Chemical, Inc.
Osaka, Japan) and 2% sucrose in a sterile square
Petri dish (140 ! 100 mm; Eiken, Tokyo, Japan).
A thaliana seeds were surface-sterilized by
soaking them in 99.5% ethanol for 2 min and
allowed to air-dry for a few hours; then they
were sown onto MGRL solid medium. After a
2-day cold acclimation at 4°C, the plates were
placed vertically, and the plants were grown at
22°C under a 16 h light:8 h dark cycle.
For microsome isolation, plants were grown
on vertically placed MGRL solid medium
containing 30 "M B for 16 days and were
hydroponically grown with MGRL liquid
medium containing 30 "M B for 4 days and then
with the medium containing 3 "M B (–B) for 4
days under a 10 h light:14 h dark cycle, followed
by treatment with the medium containing 100
"M B (+B, an optimal condition). The method
for hydroponic culture was as follows.
Twenty-five plants were placed between two
formed polyethylene sheets (15 ! 100 ! 4 mm),
and four sets of the sheets were floated on 400
ml of MGRL liquid medium in a light-shielded
plastic container. The liquid medium was
continuously aerated by an air pump and was
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
5
changed every 4 days.
Confocal fluorescent imaging–Confocal imaging
was performed as described previously with
slight modifications (18). The transgenic plants
were grown on MGRL solid medium
supplemented with 3 "M B (–B) for 4 days. The
roots were cut and incubated with MGRL liquid
medium containing boric acid, inhibitors, or
fluorescent dye at room temperature, as
described in the figure legends. A stock solution
of cycloheximide (CHX) or FM4-64 (Molecular
Probes, Carlsbad, CA, USA) was prepared with
water at 25 mM or 10 mM respectively, and
BFA (Sigma, St. Louis, MO, USA) was
prepared with DMSO at 50 mM.
Confocal imaging was performed using an
LSM510 (Carl Zeiss, Oberkochen, Germany) or
an FV1000 laser scanning confocal microscope
(Olympus, Tokyo, Japan). The excitation
wavelength was 488 nm, and emitted
fluorescence was detected with a 505–530-nm
band-pass filter for GFP or a 650-nm long-pass
filter for FM4-64. Signal intensity was
monitored to avoid pixel saturation.
At least two independent transgenic lines
(T2 or T3 plants) from each construct were used
to confirm the reproducibility of the results.
Preparation of microsomal fractions from
Arabidopsis tissues–Microsomal proteins were
prepared as described previously with some
modifications (18). The bor1-3/2-1 and
transgenic plants (T3 homo-lines) were grown
hydroponically, as described above. The roots
and shoots were harvested after treatment with
100 "M B (+B) MGRL liquid medium.
Approximately 1 g of tissues was homogenized
in 5 ml of ice-cold homogenization buffer (250
mM Tris-Cl [pH 7.8], 25 mM
ethylenediaminetetraacetic acid [EDTA], 290
mM sucrose, 75 mM 2-mercaptoethanol, 10 mM
N-etylmaleimide, 1 mM phenylmethylsulfonyl
fluoride [PMSF], and one tablet/50 ml of
protease inhibitor cocktail [complete,
EDTA-free; Roche, Indianapolis, IN, USA])
using a POLYTRON PT-2100 homogenizer
(Kinematica Inc., Bohemia, NY, USA) at 26,000
rpm for 5 s. This homogenization was repeated
four times. The homogenates were centrifuged at
8,000 ! g for 5 min at 4°C, and the supernatant
was centrifuged at 100,000 ! g for 10 min at
4°C. The microsome pellets were resuspended in
200 "l of ice-cold storage buffer (50 mM Tris-Cl
[pH 8.0], 150 mM NaCl, 10 mM
N-etylmaleimide, 1 mM PMSF, and one
tablet/50 ml of protease inhibitor cocktail
[complete, EDTA-free; Roche]) using a pestle.
The protein concentration was determined using
the Bradford method (Quick Start Protein Assay
Kit I; Bio-Rad, Hercules, CA, USA). The
samples were frozen in liquid nitrogen and
stored at –80°C.
Immunoblot analysis–Microsomes containing 20
"g of protein were dissolved in 2! solubilization
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
6
buffer (50 mM Tris-Cl [pH 7.5], 50 mM
dithiothreitol [DTT], 5% glycerol, 5% sodium
dodecyl sulfate [SDS], 5 mM EDTA, 0.03%
bromophenol blue, one tablet/10 ml of protease
inhibitor cocktail [complete mini, EDTA-free;
Roche]), incubated at 65°C for 5 min, and then
separated by SDS-polyacrylamide gel
electrophoresis (PAGE) using a modified
Laemmli system (32) with 8% acrylamide and
0.064% N,N'-methylene-bis-acrylamide. Gels
were blotted onto polyvinylidene fluoride
(PVDF) membranes (BioCraft, Tokyo, Japan) by
semidry electroblotting. The anti-GFP mouse
monoclonal antibody GF200 (Nakalai Tesque,
Kyoto, Japan) was used at 2.2 "g/ml in 2% ECL
advance blocking reagent (GE Healthcare,
Piscataway, NJ, USA). Immune complexes were
detected with horseradish peroxidase-conjugated
goat antibody to mouse IgG and ECL advance
reagents (GE Healthcare), and the
chemiluminescence was detected with an
LAS-3000 imaging system (Fujifilm, Tokyo,
Japan).
Immunoprecipitation and detection of
ubiquitination–Microsomal protein fractions (50
"g) were lysed in 300 "l of lysis buffer (20 mM
HEPES-KOH [pH 7.5], 150 mM NaCl, 1 mM
EDTA, 1% Tween 20, 0.5% deoxicholate, 0.1%
SDS, 10 mM N-ethylmaleimide, 1 mM PMSF,
and one tablet/10 ml of protease inhibitor
cocktail [Complete mini, EDTA-free; Roche]),
and incubated with 20 "l of agarose conjugated
anti-GFP monoclonal antibody (50% gel slurry;
MBL, Nagoya, Japan) for 1.5 h at 4°C with
gentle shaking. After the incubation, the beads
were washed three times with lysis buffer, and
the bound proteins were analyzed by
immunoblotting using anti-GFP antibody or
anti-ubiquitin (Ub) antibody. Anti-Ub
monoclonal antibody (P4D1; Santa Cruz
Biotechnology, Santa Cruz, CA, USA) was used
at 0.5 "g/ml in 2% ECL advance blocking
reagent.
RESULTS
The Amino Acid Sequence Involved in
Boron-Induced Degradation of BOR1–Our
previous studies demonstrated that BOR1 and
BOR4 are distinct in terms of B-induced
endocytic degradation and polar localization (14,
17); BOR1 and BOR4 localize to the inner and
outer PM domains of various root cells,
respectively, and BOR1 is degraded by +B
supplementation (Fig. 2), but BOR4 is not.
Therefore, we searched amino acid residues
involved in B-induced degradation by means of
differences between BOR1 and BOR4
sequences.
To identify the BOR1 region responsible
for B-induced degradation, we constructed two
BOR1 and BOR4 chimeras. The C-terminal
region of BOR1 was replaced with the
corresponding region of BOR4 from L468 or
E641 and called chimera 1 and chimera 2,
respectively (Fig 1). The BOR1, BOR4, and
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
7
chimeras were C-terminally fused to GFP and
placed under the control of the BOR1 promoter
were generated. To exclude the possibility that
an endogenous BOR1 or BOR2, the closest
homolog of BOR1, disturb the mutational effects
of introduced BORs through protein–protein
interactions, the constructs were introduced into
bor1-3/2-1, a double BOR1 and BOR2 mutant
without BOR1 and BOR2 accumulation. The
growth defect in the bor1-3/2-1 mutant under
B-limiting conditions was restored almost fully
by expressing BOR1-GFP and partially restored
by BOR4-GFP, chimera 1-GFP, and chimera
2-GFP (Fig. S1), indicating that these expressed
proteins possess B-transporting activity. As
shown in Fig. 2, BOR1-GFP was localized to the
PM of the root cap and epidermal cells in the
root tip with inward polarity and degraded upon
treatment with +B for 2 h. In contrast, chimera
1-GFP and BOR4-GFP did not show inward
polarity and did not disappear with +B.
Although a part of the chimera 1-GFP was
observed in the cytosol or endomembrane, most
likely endoplasmic reticulum (ER), PM
localization was confirmed by co-localization
with a specific membrane dye FM4-64 (33) (Fig.
S4). Chimera 2-GFP showed no or a weaker
polarity but was degraded by +B
supplementation. These results suggest that the
BOR1 sequence from L469 to E641 and F642 to
the last amino acid residue (N704) contains the
motif(s) for B-induced degradation and polar
localization, respectively.
Lysine 590 Is Crucial for Boron-Induced
Degradation of BOR1–We focused on potential
ubiquitination sites to identify an amino acid
residue required for boron-induced endocytic
degradation of BOR1. Ubiquitin conjugation to
the lysine residue in yeast is involved in
endocytosis and degradation of PM proteins
such as receptors, channels, and transporters (22,
34). Therefore, we searched for a lysine residue
in the region from L469 to E641 of BOR1 and
found only one lysine residue, K590, which is
not conserved in BOR4 (Fig. 1B). We
introduced a mutation to change K590 to A
(K590A). The GFP-tagged K590A mutant
(BOR1K590A-GFP) was expressed under the
control of BOR1 promoter. Several independent
transgenic plants were generated, and the
transgenic plant lines displayed almost full
restoration of the bor1-3/2-1 growth defect
under a B-limiting condition (Fig. S1). The
BOR1K590A-GFP showed inward polarity similar
to the wild-type BOR1-GFP, however,
B-induced degradation was not observed (Fig.
3A). GFP fluorescence was seen in the PM 4
days after treatment with +B (100 "M). This
result indicates that K590 is involved in BOR1
degradation. For further confirmation,
microsomes isolated from shoots and roots of
these transgenic plants after treatment with +B
were subjected to immunoblot analysis using an
anti-GFP antibody (Fig. 3C). A single band
corresponding to the expected size of full-length
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
8
BOR1-GFP or BOR1K590A-GFP (approximately
106 kDa) was detected in all root samples
indicating that the GFP fluorescence seen in Fig.
3A was derived from the full-length BOR1-GFP
protein. B-induced degradation of BOR1-GFP
was observed in the root samples but
degradation was not detected for
BOR1K590A-GFP, consistent with the results of
GFP imaging. Degradation was not observed in
either BOR1-GFP or BOR1K590A-GFP in the
shoot during this short period of time (30–120
min). In the shoot, another band was observed at
a higher weight than 250 kDa, which was
assumed to be a trimer or tetramer.
We also tested the effects of other lysine
mutations in the BOR1 C-terminal region (see
Fig. 1B), including K649A, K689A, and a
K649A/K689A double mutant. All three mutant
proteins, BOR1K649A-GFP, BOR1K689A-GFP, and
BOR1K649A,K689A-GFP, fully complemented
hypersensitivity to B deficiency of the
bor1-3/2-1 mutant (Fig. S1) and exhibited
normal polarity and B-induced degradation (Fig.
S2). These results further confirmed the
importance of K590, but not of other nearby
lysine residues.
We then tested whether K590 is sufficient
for B-induced degradation of BORs by
introducing an N590K or N590K/P591G double
mutation in chimera 1-GFP and N596K or
N596K/P597G in BOR4-GFP. These changes
represent the introduction of BOR1-type amino
acid residues at these specific positions in the
BOR4-type sequences. These constructs
partially rescued the hypersensitivity to B
deficiency of the bor1-3/2-1 mutant, confirming
B-transport activity of the BORs-GFP
derivatives (Fig. S1). These amino acid
substitutions did not induce B-dependent
degradation in both chimera 1-GFP and
BOR4-GFP (Fig. S3). The chimera 1 derivatives,
chimera 1N590K-GFP and chimera 1N590K,
P591G-GFP, as well as chimera 1-GFP, were
localized in the PM and partly in the
endomembrane, most likely the ER. The PM
localization of these proteins was further
confirmed by co-localization with FM4-64 (Fig.
S4). These results indicate that K590 is
necessary but not sufficient for B-induced
degradation of BORs.
BOR1 Is Ubiquitinated Under +B Conditions,
and Lys 590 Is the Principal Ubiquitination
Site–We assumed that BOR1 ubiquitination at
K590 was involved in B-induced degradation.
Therefore, we attempted to detect ubiquitin
conjugated to BOR1-GFP and compared that to
BOR1K590A-GFP. BOR1-GFP, BOR1K590A-GFP,
and BOR1K649A,K689A-GFP were
immunoprecipitated using the anti-GFP antibody
from root extracts of transgenic plants after a
time-course treatment with +B, and the
ubiquitination was detected by immunoblotting
using an anti-Ub antibody (Fig. 4). Two specific
ubiquitinated protein bands were observed from
BOR1-GFP and BOR1K649A,K689A-GFP within 30
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
9
min after treatment with +B. The lower and
upper bands corresponded to the size of
BOR1-GFP conjugates with one and two
ubiquitin molecules, respectively. Apparently no
ubiquitinated protein was observed for
BOR1K590A-GFP. In addition, immunoblotting
using anti-GFP detected a relatively small
amount of diubiquitinated BOR1-GFP compared
to non-ubiquitinated protein in a long-exposure
image, indicating that the ubiquitinated BOR1
protein is rapidly degraded and does not
accumulate in large amounts within plant cells.
These results suggest that BOR1 is mono- or
diubiquitinated and that K590 is essential for
ubiquitination under a +B condition. Thus, K590
is likely to be the ubiquitination site.
Lysine590 Is Essential for Vacuolar Sorting of
BOR1 But Not for Endocytosis–B-induced
turnover of BOR1 is mediated by endocytosis
and subsequent degradation in the vacuole (18).
To determine which step of the endocytic
degradation of BOR1 requires K590
ubiquitination, we compared the endocytic
trafficking of BOR1-GFP and BORK590A-GFP
using a general endocytosis marker FM4-64 (33)
and membrane traffic inhibitor brefeldin A
(BFA). BFA inhibits the transition of membrane
proteins from early endosomes (EEs) to MVBs
and to PM but allows endocytosis (35-37)
BFA treatment was performed in the
presence of cycloheximide (CHX) to prevent de
novo protein synthesis. After 30 min of BFA
treatment, both BOR1-GFP and BOR1K590A-GFP
accumulated with endocytosed FM4-64 in the
BFA compartment of root epidermal cells (Fig.
5A). The same volume of dimethyl sulfoxide
(DMSO), the BFA stock solution solvent, was
used as the control, and no effect on traffic was
observed. This result indicated that K590 is not
involved in endocytosis of BOR1 from the PM;
however, it may be involved in subsequent
vacuolar sorting steps (Fig. S6).
To exclude the possibility that K590A
simply enhanced protein synthesis and
overaccumulated BOR1 at the PM, we
monitored GFP accumulation in the root
vacuoles of transgenic plants expressing
BOR1K590A-GFP and compared that with
BOR1-GFP to confirm that the K590A mutation
inhibited BOR1 transport to the lytic vacuole. In
the absence of light, GFP is resistant to vacuolar
proteolysis; thus, dark treatment is an effective
method to visualize vacuolar targeting of
GFP-tagged proteins (14, 36, 38). The roots of
transgenic plants expressing BOR1-GFP and
BOR1K590A-GFP were incubated in low-B (–B)
and +B medium in the dark for 2 h, and GFP
fluorescence in the epidermal cells of the root tip
was monitored (Fig. 5B). After –B treatment,
fluorescence from both BOR1-GFP and
BOR1K590A-GFP was observed in the PM. After
+B treatment, GFP fluorescence in the
BOR1-GFP expressing plant was observed in
the vacuole as previously reported (14), whereas
fluorescence in the BOR1K590A-GFP expressing
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
10
plant was not detected in the vacuole but was
retained in the PM. This observation confirmed
that the K590A mutation prevents sorting of
BOR1 into the vacuole under a +B condition.
We also investigated the effect of
wortmannin (WM) on trafficking of BOR1-GFP
and BOR1K590A-GFP. WM is a specific inhibitor
of phosphatidyl-inositol 3-kinase and induces
homotypic fusions and enlargement of the
prevacuolar compartment (PVC)/LE/MVB in
plants (39-41). In agreement with a previous
study (40), BOR1-GFP was observed in several
round structures after 90 min of 16.5 "M WM
treatment both in +B and –B medium (Fig. 5C,
D) A part of the GFP signal in the round
structures were co-localized with the endocytic
dye FM4-64, indicating that the structures are
enlarged PVC/LE/MVB. In contrast,
BOR1K590A-GFP was rarely observed in
enlarged MVBs. This result suggested that
BOR1K590A-GFP is scarcely able to enter the
MVB pathway.
Taken together, these data suggest that
K590 is not involved in the endocytosis of
BOR1 from the PM but is essential for sorting in
MVBs for subsequent vacuolar degradation (Fig.
S6).
DISCUSSION
We showed that BOR1 is biochemically
modified with mono- or diubiquitin in response
to B availability, and that a K590 residue is
required for both B-induced ubiquitination and
B-induced endocytic degradation. Mutational
analysis showed that a K590A mutant,
BOR1K590A-GFP, was not degraded under +B
conditions unlike BOR1-GFP (Fig. 3), indicating
that K590 is required for B-induced endocytic
degradation. Our most recent work revealed the
other BOR1 residues involved in endocytic
degradation (14): three putative tyrosine-based
sorting signals (YXXØ: Y, tyrosine; X, any
amino acid; Ø, a bulky hydrophobic residue) in
the predicted largest cytosolic loop region. The
tyrosine-based sorting signal is recognized by
the clathrin-adaptor protein (AP) complex for
sorting transmembrane proteins into
clathrin-coated vesicles and is involved in many
post-Golgi trafficking steps including
endocytosis and polar PM trafficking (42).
Mutations in all of the corresponding tyrosines
(Y373A/Y398A/Y405A) of BOR1 prevent
B-induced degradation. Additionally, the
tyrosine mutations inhibit polar localization in
the root tip cells. In contrast, the K590A
mutation inhibits only endocytic degradation and
does not affect polar localization (Fig. 3),
indicating that K590 is specifically required for
BOR1 vacuolar trafficking. We also showed that
introducing an N590K or N590K/P591G
mutation into the chimera 1-GFP and N596K or
N596K/P597G in BOR4-GFP did not promote
B-induced degradation in both chimera 1-GFP
and BOR4-GFP (Fig. S3), indicating that K590
is necessary but not sufficient for endocytic
degradation. Although BOR4 lacks two tyrosine
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
11
residues corresponding to putative
tyrosine-based sorting signals of BOR1, Y373,
and Y405 (Fig. S5), chimera 1-GFP mutants
contain all of the putative tyrosine-based sorting
signals. This suggests the existence of extra
component(s) other than the three tyrosine-based
sorting signals and indicates that K590 functions
in BOR1 endocytic degradation.
Immunoprecipitation and immunoblotting
analyses showed that BOR1 is mono- or
diubiquitinated in a +B-dependent manner and
that K590 is likely a principal ubiquitin-acceptor
site (Fig. 4). Our data are consistent with studies
in yeast showing that several nutrient
transporters are posttranslationally
down-regulated by substrate-dependent mono-
or multi-monoubiquitination (22, 34). Diverse
forms of ubiquitination are involved in the
distinct membrane protein degradation pathways
in yeast and mammalian systems (19);
polyubiquitination mainly regulates proteasomal
degradation, and mono- or
multi-monoubiquitination is required for the
endocytic degradation pathway. In mammals,
K63-linked short-chain ubiquitination and di- or
triubiquitination at the K270 lysine residue
regulates endocytosis of the aquaporin-2 water
channel (43). As a PM localized protein in plants,
PIN2 has been shown to be ubiquitinated (26).
Another report demonstrated that endocytically
internalized PIN2 is degraded mainly in the
vacuole (36). However, for PIN2,
signal-inducing ubiquitination, which is a direct
link between ubiquitination and turnover, the
form of ubiquitination, and the ubiquitination
site are still unknown. Another example is that
downregulation of PIP2, a PM aquaporin, is
regulated via ubiquitination catalyzed by
drought stress-induced Rma1, a homolog of a
RING domain containing E3 ligase in A thaliana
(44). In addition, A thaliana iron regulated
transporter 1 (IRT1), a high affinity iron
transporter, is also posttranslationally regulated
in response to iron availability, and two lysine
residues in the intercellular roop region are
necessary for iron-induced turnover (45).
However, IRT1 ubiquitination has not yet been
reported. Our results show the ubiquitiantion
form, an ubiquitination site, and inducibility by
substrate availability (Fig. 4), thus filling a gap
in the current knowledge regarding
posttranslational turnover of PM proteins in
plants. Our findings suggest that plants are able
to use mono- or diubiquitination as critical
labeling to identify endocytic degradation of PM
proteins.
Our previous report showed that after
treatment with +B for 30–60 min, BOR1-GFP is
translocated into dot-like structures
corresponding to MVBs (18, 23). However,
BOR1K590A-GFP was not observed as dot-like
signals after +B treatment (Fig. 3). Furthermore,
while BOR1-GFP was observed in enlarged
MVBs following WM treatment even under a
–B condition, BOR1K590A-GFP was much less
frequently observed in enlarged MVBs. This
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
12
observation suggests that a pool of BOR1-GFP
is transferred into MVBs even under a –B
condition, and that this MVB sorting is largely
dependent on K590.
In yeast, many PM proteins require mono-
or multi-monoubiquitination for the endocytic
internalization step (22). In contrast,
ubiquitination of epidermal growth factor
receptor (EGFR) in animals is not necessary for
endocytic internalizaion from the PM but is
required for lysosomal sorting (46). Similar to
EGFR, the K590 of BOR1 seems not to be
involved in the endocytosis from the PM but is
essential for transport to the MVB pathway and
then to the vacuole (Fig. 5 and Fig. S6). This
result agrees with the observation that
BOR1K590A-GFP and wild-type BOR1-GFP
showed inward polarity (Fig. 2 and Fig. 3)
because endocytic cycling is required to
maintain polar localization of PM proteins (14,
42). Substrate-induced degradation of number of
yeast nutrient transporters is regulated at the
endocytic internalization step (22). It is
considered to be an efficient way because
unicellular yeast does not require endocytically
generated polarity of nutrient transporters for
efficient nutrient uptake. However, plants might
require continuous endocytic recycling of their
nutrient transporters to maintain polar
localization for directional nutrient transport
under a nutrient-deficient condition. One may
reasonably assume that plants have independent
regulatory mechanisms for endocytosis
(internalization from PM) and vacuolar sorting.
In conclusion, the data presented here show
that B-induced mono- or diubiquitination of
BOR1 at K590 is essential transport step to
MVBs, and the ubiquitination does not control
the rate of endocytosis from the PM, (Fig. S6).
This mechanism is distinct from that of the yeast
system and may be important in enabling polar
localized plant nutrient transporters to achieve a
balance between the polar localization and the
vacuolar degradation systems. BOR1 is a good
model for studying endocytic degradation of
transmembrane proteins in plants because
degradation and ubiquitination can be controlled
by only one amino acid residue. Further studies
may show how plants sense the concentration of
B and regulate ubiquitination in a B-dependent
manner.
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
13
REFERENCES
1. Shorrocks VM (1997) The occurrence and correction of boron deficiency. Plant and Soil
193(1-2):121-148.
2. Nable RO, Banuelos GS, & Paull JG (1997) Boron toxicity. Plant and Soil 193(1-2):181-198.
3. O'Neill MA, Eberhard S, Albersheim P, & Darvill AG (2001) Requirement of borate
cross-linking of cell wall rhamnogalacturonan II for Arabidopsis growth. Science
294(5543):846-849.
4. Iwai H, et al. (2006) The gene responsible for borate cross-linking of pectin
Rhamnogalacturonan-II is required for plant reproductive tissue development and fertilization.
Proceedings of the National Academy of Sciences of the United States of America
103(44):16592-16597.
5. Ruiz JM, Rivero RM, & Romero L (2003) Preliminary studies on the involvement of
biosynthesis of cysteine and glutathione concentration in the resistance to B toxicity in
sunflower plants. Plant Science 165(4):811-817.
6. Reid RJ, Hayes JE, Post A, Stangoulis JCR, & Graham RD (2004) A critical analysis of the
causes of boron toxicity in plants. Plant Cell and Environment 27(11):1405-1414.
7. Nozawa A, Miwa K, Kobayashi M, & Fujiwara T (2006) Isolation of Arabidopsis thaliana
cDNAs that confer yeast boric acid tolerance. Biosci Biotechnol Biochem 70(7):1724-1730.
8. Nozawa A, Takano J, Kobayashi M, von Wirén N, & Fujiwara T (2006) Roles of BOR1,
DUR3, and FPS1 in boron transport and tolerance in Saccharomyces cerevisiae. FEMS
Microbiol Lett 262(2):216-222.
9. Ochiai K, Uemura S, Shimizu A, Okumoto Y, & Matoh T (2008) Boron toxicity in rice
(Oryza sativa L.). I. Quantitative trait locus (QTL) analysis of tolerance to boron toxicity.
Theor Appl Genet 117(1):125-133.
10. Takano J, et al. (2002) Arabidopsis boron transporter for xylem loading. Nature
420(6913):337-340.
11. Takano J, et al. (2006) The Arabidopsis major intrinsic protein NIP5;1 is essential for efficient
boron uptake and plant development under boron limitation. Plant Cell 18(6):1498-1509.
12. Takano J, Miwa K, & Fujiwara T (2008) Boron transport mechanisms: collaboration of
channels and transporters. Trends Plant Sci 13(8):451-457.
13. Frommer WB & von Wirén N (2002) Plant biology: Ping-pong with boron. Nature
420(6913):282-283.
14. Takano J, et al. (2010) Polar localization and degradation of Arabidopsis boron transporters
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
14
through distinct trafficking pathways. Proc Natl Acad Sci U S A 107(11):5220-5225.
15. Miwa K, Takano J, & Fujiwara T (2006) Improvement of seed yields under boron-limiting
conditions through overexpression of BOR1, a boron transporter for xylem loading, in
Arabidopsis thaliana. Plant J 46(6):1084-1091.
16. Kato Y, Miwa K, Takano J, Wada M, & Fujiwara T (2009) Highly boron deficiency-tolerant
plants generated by enhanced expression of NIP5;1, a boric acid channel. Plant Cell Physiol
50(1):58-66.
17. Miwa K, et al. (2007) Plants tolerant of high boron levels. Science 318(5855):1417.
18. Takano J, Miwa K, Yuan L, von Wirén N, & Fujiwara T (2005) Endocytosis and degradation
of BOR1, a boron transporter of Arabidopsis thaliana, regulated by boron availability. Proc
Natl Acad Sci U S A 102(34):12276-12281.
19. Mukhopadhyay D & Riezman H (2007) Proteasome-independent functions of ubiquitin in
endocytosis and signaling. Science 315(5809):201-205.
20. Raiborg C & Stenmark H (2009) The ESCRT machinery in endosomal sorting of
ubiquitylated membrane proteins. Nature 458(7237):445-452.
21. Saksena S, Sun J, Chu T, & Emr SD (2007) ESCRTing proteins in the endocytic pathway.
Trends Biochem Sci 32(12):561-573.
22. Hicke L & Dunn R (2003) Regulation of membrane protein transport by ubiquitin and
ubiquitin-binding proteins. Annu Rev Cell Dev Biol 19:141-172.
23. Viotti C, et al. (2010) Endocytic and secretory traffic in Arabidopsis merge in the trans-Golgi
network/early endosome, an independent and highly dynamic organelle. Plant Cell
22:1344-1357.
24. Katzmann DJ, Babst M, & Emr SD (2001) Ubiquitin-dependent sorting into the multivesicular
body pathway requires the function of a conserved endosomal protein sorting complex,
ESCRT-I. Cell 106(2):145-155.
25. Spitzer C, et al. (2009) The ESCRT-related CHMP1A and B proteins mediate multivesicular
body sorting of auxin carriers in Arabidopsis and are required for plant development. Plant
Cell 21(3):749-766.
26. Abas L, et al. (2006) Intracellular trafficking and proteolysis of the Arabidopsis auxin-efflux
facilitator PIN2 are involved in root gravitropism. Nat Cell Biol 8(3):249-256.
27. Higuchi R, Krummel B, & Saiki RK (1988) A general method of in vitro preparation and
specific mutagenesis of DNA fragments: study of protein and DNA interactions. Nucleic
Acids Res 16(15):7351-7367.
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
15
28. Koncz C & Schell J (1986) The Promoter of Tl-DNA Gene 5 Controls the Tissue-Specific
Expression of Chimeric Genes Carried by a Novel Type of Agrobacterium Binary Vector.
Molecular & General Genetics 204(3):383-396.
29. Clough SJ & Bent AF (1998) Floral dip: a simplified method for Agrobacterium-mediated
transformation of Arabidopsis thaliana. Plant J 16(6):735-743.
30. Alonso JM, et al. (2003) Genome-wide insertional mutagenesis of Arabidopsis thaliana.
Science 301(5633):653-657.
31. Fujiwara T, Hirai MY, Chino M, Komeda Y, & Naito S (1992) Effects of Sulfur Nutrition on
Expression of the Soybean Seed Storage Protein Genes in Transgenic Petunia. Plant Physiol
99(1):263-268.
32. Ito K, Bassford PJ, Jr., & Beckwith J (1981) Protein localization in E. coli: is there a common
step in the secretion of periplasmic and outer-membrane proteins? Cell 24(3):707-717.
33. Bolte S, et al. (2004) FM-dyes as experimental probes for dissecting vesicle trafficking in
living plant cells. J Microsc 214(Pt 2):159-173.
34. Rotin D, Staub O, & Haguenauer-Tsapis R (2000) Ubiquitination and endocytosis of plasma
membrane proteins: role of Nedd4/Rsp5p family of ubiquitin-protein ligases. J Membr Biol
176(1):1-17.
35. Robinson DG, Jiang L, & Schumacher K (2008) The endosomal system of plants: charting
new and familiar territories. Plant Physiol 147(4):1482-1492.
36. Kleine-Vehn J, et al. (2008) Differential degradation of PIN2 auxin efflux carrier by
retromer-dependent vacuolar targeting. Proc Natl Acad Sci U S A 105(46):17812-17817.
37. Geldner N, Hyman DL, Wang X, Schumacher K, & Chory J (2007) Endosomal signaling of
plant steroid receptor kinase BRI1. Genes Dev 21(13):1598-1602.
38. Tamura K, et al. (2003) Why green fluorescent fusion proteins have not been observed in the
vacuoles of higher plants. Plant J 35(4):545-555.
39. Tse YC, et al. (2004) Identification of multivesicular bodies as prevacuolar compartments in
Nicotiana tabacum BY-2 cells. Plant Cell 16(3):672-693.
40. Jaillais Y, Fobis-Loisy I, Miège C, & Gaude T (2008) Evidence for a sorting endosome in
Arabidopsis root cells. Plant J 53(2):237-247.
41. Wang J, Cai Y, Miao Y, Lam SK, & Jiang L (2009) Wortmannin induces homotypic fusion of
plant prevacuolar compartments. J Exp Bot 60(11):3075-3083.
42. Mellman I & Nelson WJ (2008) Coordinated protein sorting, targeting and distribution in
polarized cells. Nat Rev Mol Cell Biol 9(11):833-845.
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
16
43. Kamsteeg EJ, et al. (2006) Short-chain ubiquitination mediates the regulated endocytosis of
the aquaporin-2 water channel. Proc Natl Acad Sci U S A 103(48):18344-18349.
44. Lee HK, et al. (2009) Drought stress-induced Rma1H1, a RING membrane-anchor E3
ubiquitin ligase homolog, regulates aquaporin levels via ubiquitination in transgenic
Arabidopsis plants. Plant Cell 21(2):622-641.
45. Kerkeb L, et al. (2008) Iron-induced turnover of the Arabidopsis IRON-REGULATED
TRANSPORTER1 metal transporter requires lysine residues. Plant Physiol
146(4):1964-1973.
46. Duan L, et al. (2003) Cbl-mediated ubiquitinylation is required for lysosomal sorting of
epidermal growth factor receptor but is dispensable for endocytosis. J Biol Chem
278(31):28950-28960.
FOOTNOTES
Acknowledgements– We are grateful to Takehiro Kamiya, Kentaro Fuji, and Shimpei Uraguchi for
their helpful discussion and critical reading of the manuscript.
This work was supported, in part, by a Grant-in-Aid for JSPS Fellows (no. 19-7094 to K.K.) from the
Japan Society for the Promotion of Science, a Grant-in-Aid for Scientific Research (to T.F.), and a
Grant-in-Aid for Scientific Research Priority Areas (to T.F.) from the Ministry of Education, Culture,
Sports, Science and Technology, Japan.
The abbreviations used are: B, boron; -B, low-boron; +B, high-boron; PM, plasma membrane; EE,
early endosomes; LE, late endosomes; MVBs, multivesicular bodies; Anti-Ub, Anti-ubiquitin.
FIGURE LEGEND
FIGURE 1 Construction of a BOR1 and BOR4 chimera. A, schematic representation of constructs.
The BOR1 topology model predicted by ConPred II (Arai et al, 2004) is shown at the top. Ten
deduced transmembrane (TM) domains are indicated by black boxes, and the “I” and “o” represent
inside and outside of the cell, respectively. BOR1, BOR4, and two BOR1–BOR4 chimeras, chimera 1
and chimera 2, were tagged with GFP at the C-terminal and inserted under the control of the BOR1
promoter (PBOR1). White, gray, and black segments represent BOR1, BOR4, and GFP sequences,
respectively. The amino acids positions of BOR1 and BOR4 at the chimera junctions are shown. B,
comparison of the C-terminal amino acid sequences of BOR1 (Glu443 to Asn704) and BOR4 (Glu449
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
17
to Glu683). The positions of the two chimera junctions are indicated. The BOR1 unique lysine
residues are denoted by white triangles.
FIGURE 2 Effects of high boron treatment on the subcellular localization of BOR1-GFP,
BOR4-GFP, chimera 1-GFP, and chimera 2-GFP in root cells. A, GFP images from the roots of
transgenic A thaliana expressing BOR1-GFP, BOR4-GFP, chimera 1-GFP, and chimera 2-GFP. Plants
were grown on solid medium with a low boron concentration (–B) and then incubated with –B or
high-B (+B) liquid medium for 2 h. Scale bar represents 50 "m. B, Enlarged views of the epidermal
cells of (A) under the –B condition showing distinct polar localizations. The white arrows indicate the
direction of the polarity. In, Inward; Ou, outward; Bar, 5 "m.
FIGURE 3 Interference with the boron (B)-dependent degradation of BOR1 by a K590A point
mutation. A, GFP images from the roots of transgenic A. thaliana expressing BOR1K590A-GFP. Plants
were grown on solid medium with low B concentration (–B) and then incubated with a high B
concentration (+B) for 2 h (+B2h) or 5 h (+B5h). Plants were also grown on solid medium with a +B
for 4 days (+B4d). Scale bar represents 50 "m. B, enlarged views of the epidermal cells of (A) under a
–B condition. The white arrows indicate the direction of the polarity. In, Inward; Ou, outward; Bar, 5
"m. C, Immunoblot analysis of microsomal fractions from roots and shoots of transgenic plants
expressing BOR1-GFP and BOR1K590A-GFP. The plants were grown on –B medium and then treated
with +B for the indicated time periods. Microsomal proteins were separated by SDS-PAGE and
blotted onto PVDF membranes. The blots were reacted with anti-GFP antibody. Control, microsomes
from bor1-3/2-1. “T” and “M” are the deduced trimer and monomer, respectively. The sizes of the
molecular markers are shown in kDa. CBB-stained membranes are shown as loading controls.
FIGURE 4 Boron (B)-dependent mono- or diubiquitination of BOR1, and involvement of K590
in the ubiquitinations. The microsomal fractions were prepared from the roots of transgenic plants
expressing BOR1-GFP, BOR1K590A-GFP, and BOR1K648A,K689A-GFP, which were grown in low-B (–B)
medium and then treated with a high-B (+B) concentration for the indicated times. The GFP-tagged
proteins were immunoprecipitated with anti-GFP antibody, and ubiquitination was assessed by
immunoblotting with anti-Ubi antibody. “m” and “d” represent the presumed band sizes for the
monoubiquitination and diubiquitination, respectively. Arrowhead indicates the presumed
diubiquitination band detected during a long image exposure of anti-GFP.
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
18
FIGURE 5 Effects of the K590A mutation on the intracellular membrane trafficking of BOR1. A,
Intracellular distribution of BOR1-GFP and BOR1K590A-GFP after treatment with brefeldin A (BFA).
The roots from transgenic plants grown on the low-boron (–B) medium were incubated with 50 "M
cycloheximide (CHX) for 30 min and then with 25 "M FM4-64 for 2 min followed by treatment with
50 "M CHX and 50 "M BFA. The GFP and FM4-64 signals in the epidermal cells are shown in green
and red, respectively. In the merged images, the GFP and FM4-64 overlapping signals appear in
yellow. DMSO was used as a negative control. Arrowheads indicate examples of BOR1-GFP and
FM4-64 (top), and BOR1K590A-GFP and FM4-64 (bottom) co-localization. Bar, 5 "m. B, Distribution
of GFP signals derived from BOR1-GFP or BOR1K590A-GFP in the epidermal cells of the root tips
after treatment with high-B (+B) or –B in the dark (2 h). Arrowhead indicates GFP signals in the
vacuole. Bar, 10 "m. C, Distribution of BOR1-GFP and BOR1K590A-GFP after treatment with
wortmannin (WM) in the epidermal cells of the root tips. The roots were incubated with –B medium
containing 4 "M FM4-64 for 90 min, and then with +B or –B medium containing 16.5 "M WM or
0.0825 % DMSO for 90 min. Arrowheads indicate co-localization. Bar, 60 "m. D, Magnified images
of the boxed areas in (C). Bar, 10 "m.
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
A
B
GFP
BOR4
BOR1
BOR1
K590
K689
K649
K649
K689
L468 (BOR1)
E641(BOR1)
L650 (BOR4)
(BOR4)Q475
Pbor1
PBOR1-BOR1-GFP
PBOR1-BOR4-GFP
1kbp
PBOR1-chimera 1-GFP
PBOR1-chimera 2-GFP
N-ter C-ter
i i i i i io o o o o
1 2 3 4 5 6 7 8 9 10
QSTMVGGCVAAMPILKMIPTSVLWGYFAFMAIESLPGNQFWERILLLFTAPSRRFKVLEDY
QSLLVAGAVLAMPAIKLIPTSILWGYFAYMAIDSLPGNQFFERLTLLFVPTSRRFKVLEGA
ETLFDIEKEIDDLLPVEVKEQRVSNLL
ESGFDPEKHLDAYLPVRVNEQRVSNLL
H
H
BOR1
BOR4
443
449
531
537
I
D
GSTTSYPGDLEILDEVMTRSRGEFRHTSSPKVTSSSST
SKRGVQEGDAEILDELTT-SRGELKVRTLN--------
PVNNRSLSQVFSPRVSGIRLGQMSPRVVGNSPKPASCGRSPLNQSSSN
-LNEDKGNQIYPKEKVKAGDGDMSTTRE--------------------
BOR1
BOR4
618
627
704
683
BOR1
BOR4
K590
ATFVETVPFKTIAMFTLFQTTYLLICFGLTWIP
ASFVEKVPYKSMAAFTLLQIFYFGLCYGVTWIP
IAGVMFPLMIMFLIPVRQYLLPRFFKGAHLQDLDAAEYEEAPALPFN---LAAE
VAGIMFPVPFFLLIAIRQYILPKLFNPAHLRELDAAEYEEIPGTPRNPLELSFR
TE
SN
BOR1
BOR4
532
538
617
626
TM10
TM9
chimera 1
BOR1
BOR4
chimera 2
TM-
FIGURE 1
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
BO
R1
-GF
P
–BA B+B
BO
R4
-GF
PC
him
era 1
-GF
PC
him
era 2
-GF
P
Ou In
Ou In
Ou In
Ou In
BO
R1
-GF
PB
OR
4-G
FP
Ch
imera 1
-GF
PC
him
era 2
-GF
P
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
250
(kDa)
150
100
75
100
75
50
root shoot
0 30
60
120
0 30
60
120
0 30
60
120
(min)
BOR1-GFP
BOR1K590A
-GFPBOR1-GFP
Co
ntr
ol
Co
ntr
ol
A B
C
Ou In
+B4d+B5h
-B +B2h
CBB
T
M
0 30
60
120
BOR1K590A
-GFP
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
anti-Ub
anti-GFP
anti-GFP
long-exposure
0 30 60 0 30 60120 0
dm
30 60 120 (min)
BOR1
-GFP
BOR1K590A
-GFP
BOR1K649A,689A
-GFP
250
150
100
75
100
75
100
50
(kDa)
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
BFA DMSO
GFP
FM4-64
merged
GFP
FM4-64
merged
GFP mergedFM4-64
GFP mergedFM4-64 GFP mergedFM4-64
BOR1-GFP
BOR1K590A-GFP
BOR1-GFP
BOR1K590A-GFP
BA
C
D
BOR1-GFP
BOR1K590A-GFP
-B+B
-B+B
WM DMSO
GFP mergedFM4-64
-B +B
-B +B
a
a b
b
FIGURE 5
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from
Koji Kasai, Junpei Takano, Kyoko Miwa, Atsushi Toyoda and Toru FujiwaraArabidopsis thalianatransporter in
High boron-induced ubiquitination regulates vacuolar sorting of the BOR1 borate
published online December 9, 2010J. Biol. Chem.
10.1074/jbc.M110.184929Access the most updated version of this article at doi:
Alerts:
When a correction for this article is posted•
When this article is cited•
to choose from all of JBC's e-mail alertsClick here
Supplemental material:
http://www.jbc.org/content/suppl/2010/12/13/M110.184929.DC1
by guest on October 24, 2020
http://ww
w.jbc.org/
Dow
nloaded from